SAB1408931

Monoclonal Anti-GPR180 antibody produced in mouse

clone 1D8, purified immunoglobulin, buffered aqueous solution

• Sinónimos: ITR
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 1D8, monoclonal
• Formulario: buffered aqueous solution
• mol peso: antigen 36.74 kDa
• reactividad de especies: human
• técnicas: indirect ELISA: suitable
• isotipo: IgG1κ
• Nº de acceso NCBI: NM_180989
• Nº de acceso UniProt: Q86V85
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... GPR180(160897)

Descripción

Descripción general

This gene encodes a protein that is a member of the G protein-coupled receptor superfamily. This protein is produced predominantly in vascular smooth muscle cells and may play an important role in the regulation of vascular remodeling. (provided by RefSeq)

Inmunógeno

GPR180 (NP_851320.1, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QGKTLRGSFSSTAAQDAQGQRIGHFEFHGDHALLCVRINNIAVAVGKEAKLYLFQAQEWLKLQQSSHGYSCSEKLSKAQLTMTMNQTEHNLTVSQIPSPQ

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 12 - Non Combustible Liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable