SAB1407100

Anti-DUSP14 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Sinónimos: MKP-L, MKP6
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: antigen ~22.3 kDa
• reactividad de especies: human
• técnicas: indirect immunofluorescence: suitable; western blot: 1 μg/mL
• Nº de acceso NCBI: NM_007026.1
• Nº de acceso UniProt: O95147
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... DUSP14(11072)

Descripción

Descripción general

In addition to antigen recognition by the T-cell receptor, T-cell activation requires a second signal from a costimulatory receptor, such as CD28 (MIM 186760), which interacts with B7-1 (CD80; MIM 112203) and B7-2 (CD86; MIM 601020) ligands on antigen-presenting cells. CD28 costimulation induces transcription of interleukin-2 (IL2; MIM 147680) and stabilizes newly synthesized IL2 through the activation of mitogen-activated protein kinases (MAPKs), such as ERK (e.g., MAP2K4; MIM 601335) and JNK (see MIM 601158), and the subsequent creation of AP1 transcription factor (see MIM 165160). DUSP14 is a negative regulator of CD28 signaling.[supplied by OMIM

Inmunógeno

DUSP14 (NP_008957.1, 1 a.a. ~ 198 a.a) full-length human protein.

Sequence
MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI

Aplicación

Anti-DUSP14 antibody produced in mouse is suitable for indirect immunofluorescence and western blot assay.

Acciones bioquímicas o fisiológicas

DUSP14 (Dual specificity phosphatase 14) is associated with several critical signaling pathways. It has ability to dephosphorylate both phosphotyrosine and phosphoserine/phosphothreonine residues on substrates. DUSP14 controls MAPK (mitogen-activated protein kinase) signaling pathway by dephosphorylating MAPK proteins ERK (extracellular-signal-regulated kinase), JNK (c-Jun N-terminal kinase) and p38. It has been reported that DUSP14 participates in T cell proliferation as a negative-feedback regulator.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable