SAB1404941

Monoclonal Anti-C1QR1 antibody produced in mouse

clone 1A4, purified immunoglobulin, buffered aqueous solution

• Sinónimos: C1QR1, C1qR(P), C1qRP, CDw93, MXRA4, dJ737E23.1
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1A4, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37.99 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG3λ
• NCBI accession no.: NM_012072
• UniProt accession no.: Q9NPY3
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CD93(22918)

Descripción

General description

The protein encoded by this gene is a cell-surface glycoprotein and type I membrane protein that was originally identified as a myeloid cell-specific marker. The encoded protein was once thought to be a receptor for C1q, but now is thought to instead be involved in intercellular adhesion and in the clearance of apoptotic cells. The intracellular cytoplasmic tail of this protein has been found to interact with moesin, a protein known to play a role in linking transmembrane proteins to the cytoskeleton and in the remodelling of the cytoskeleton. (provided by RefSeq)

Immunogen

CD93 (NP_036204, 33 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKR

Physical form

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Storage Class: 13 - Non Combustible Solids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable