SAB1404862

Monoclonal Anti-NUDC antibody produced in mouse

clone 6F12, purified immunoglobulin, buffered aqueous solution

• Sinónimos: HNUDC, MNUDC, NPD011
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 6F12, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~62.52 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• NCBI accession no.: BC002399
• UniProt accession no.: Q9Y266
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... NUDC(10726)

Descripción

General description

NudC was first identified as a regulator of nuclear movement in the asexual reproductive cycle of the filamentous fungus Aspergillus nidulans. Human NUDC is a nuclear movement protein that associates with dynein (see DYNC1H1; MIM 600112) (Aumais et al., 2003 [PubMed 12679384]).[supplied by OMIM

Immunogen

NUDC (AAH02399, 1 a.a. ~ 331 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEGEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN

Physical form

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable