Saltar al contenido
MilliporeSigma
Todas las fotos(5)

Documentos clave

SAB1404696

Sigma-Aldrich

Monoclonal Anti-MAPKAPK2 antibody produced in mouse

clone 3B8, purified immunoglobulin, buffered aqueous solution

Sinónimos:

MK2

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μG
$541.00

$541.00


Envío en 2 semanas. (Para pedidos fuera de Estados Unidos y Europa, calcule la entrega 1 o 2 semanas más tarde)


Seleccione un Tamaño

Cambiar Vistas
100 μG
$541.00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

$541.00


Envío en 2 semanas. (Para pedidos fuera de Estados Unidos y Europa, calcule la entrega 1 o 2 semanas más tarde)

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

3B8, monoclonal

Formulario

buffered aqueous solution

mol peso

antigen ~35.57 kDa

reactividad de especies

human

técnicas

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... MAPKAPK2(9261)

Categorías relacionadas

Descripción general

Mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2) gene encodes a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo. Two transcript variants encoding two different isoforms have been found for this gene. (provided by RefSeq)The gene is located on human chromosome 1q32.1. It consists of an autoinhibitory domain, a helix-turn-helix structure, which occupies the substrate binding cleft of the kinase domain and inhibits kinase function.

Inmunógeno

MAPKAPK2 (NP_116584, 266 a.a. ~ 352 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDV

Acciones bioquímicas o fisiológicas

Mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2) is involved in cytokine production and cell migration. Overexpression of MAPKAPK2 confers multiple myeloma (MM) resistance to chemotherapy. It phosphorylates the proteins found in the nucleus and cytoplasm. This protein confers gemcitabine sensitivity in pancreatic cancer cells. The protein is required for tumor necrosis factor (TNF) biosynthesis. It is linked to tumorigenesis and drug resistance. The protein functions as a prognostic marker for lung cancer.

Forma física

Solution in phosphate buffered saline, pH 7.4

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

MK2-TNF-Signaling Comes Full Circle
Menon MB, et al.
Trends in Biochemical Sciences (2017)
The MAPK-activated protein kinase 2 mediates gemcitabine sensitivity in pancreatic cancer cells
Kopper F, et al.
Cell Cycle, 13(6), 884-889 (2014)
A functional copy-number variation in MAPKAPK2 predicts risk and prognosis of lung cancer
Liu B, et al.
American Journal of Human Genetics, 91(2), 384-390 (2012)
MAPKAPK2 (mitogen-activated protein kinase-activated protein kinase 2)
Felix R, et al.
Atlas of Genetics and Cytogenetics in Oncology and Haematology (2011)

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico