SAB1403361

Monoclonal Anti-LENG4 antibody produced in mouse

clone 1D4, purified immunoglobulin, buffered aqueous solution

• Sinónimos: BB1, LENG4, LPIAT, hMBOA-7
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1D4, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~36.78 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; indirect ELISA: suitable
• isotype: IgG2aκ
• NCBI accession no.: NM_024298
• UniProt accession no.: Q96N66
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... MBOAT7(79143)

Descripción

General description

Membrane bound O-acyltransferase domain containing 7 (MBOAT7) or LENG4 belongs to membrane-bound O-acyltransferase family. The gene encoding it is localized on human chromosome 19q13.42.

Mouse monoclonal antibody raised against a partial recombinant LENG4.

Immunogen

LENG4 (NP_077274.2, 96 a.a. ~ 192 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TPTPFTNAVQLLLTLKLVSLASEVQDLHLAQRKEMASGFSKGPTLGLLPDVPSLMETLSYSYCYVGIMTGPFFRYRTYLDWLEQPFPGAVPSLRPLL

Biochem/physiol Actions

Membrane bound O-acyltransferase domain containing 7 (MBOAT7) or LENG4 is an integral membrane protein important for reacylation of phospholipids. LENG4 is highly specific for arachidonoyl-coenzyme A and is involved in arachidonate recycling. It interacts with the small subunit of serine palmitoyltransferase a (ssSPTa). This interaction is important for LENG4-dependent incorporation of arachidonic acid into phosphatidylinositol.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable