Saltar al contenido
MilliporeSigma
Todas las fotos(2)

Documentos clave

SAB1403138

Sigma-Aldrich

Monoclonal Anti-SLC7A8, (C-terminal) antibody produced in mouse

clone 3F10, purified immunoglobulin, buffered aqueous solution

Sinónimos:

LAT2, LPI-PC1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

3F10, monoclonal

Formulario

buffered aqueous solution

mol peso

antigen ~33.7 kDa

reactividad de especies

human

técnicas

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SLC7A8(23428)

Descripción general

Solute carrier family 7 member 8 (SLC7A8), also known as L-amino acid transporter-2 (LAT-2), is part of the amino acid transporters family. It is a subunit of the heavy chain of the surface antigen 4F2 (4F2hc). The protein is expressed in the placenta and fetal capillaries. The SLC7A8 gene is localized on human chromosome 14q11.2.

Inmunógeno

SLC7A8 (NP_036376.2, 467 a.a. ~ 535 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VYWQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP

Acciones bioquímicas o fisiológicas

Solute carrier family 7 member 8 (SLC7A8) is involved in amino acid transport.It has a role in absorption of neutral amino acids in the kidney. Mutations in the gene encoding this protein have been linked to lysinuric protein intolerance.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Identification of a membrane protein, LAT-2, that Co-expresses with 4F2 heavy chain, an L-type amino acid transport activity with broad specificity for small and large zwitterionic amino acids.
Pineda M
The Journal of Biological Chemistry (1999)
Expression and functional characterisation of System L amino acid transporters in the human term placenta.
Gaccioli F
Reproductive Biology and Endocrinology (2015)
SLC7A7, encoding a putative permease-related protein, is mutated in patients with lysinuric protein intolerance.
Borsani G
Nature Genetics (1999)
Reabsorption of neutral amino acids mediated by amino acid transporter LAT2 and TAT1 in the basolateral membrane of proximal tubule.
Park SY
Archives of Pharmacal Research (2005)
Wen Deng et al.
Nature communications, 11(1), 304-304 (2020-01-18)
Biological processes in development and disease are controlled by the abundance, localization and modification of cellular proteins. We have developed versatile tools based on recombinant E3 ubiquitin ligases that are controlled by light or drug induced heterodimerization for nanobody or

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico