SAB1402233

Monoclonal Anti-HSPA4 antibody produced in mouse

clone 3A11, purified immunoglobulin, buffered aqueous solution

• Sinónimos: APG-2, HS24/P52, MGC131852, RY, hsp70, hsp70RY
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 3A11, monoclonal
• Formulario: buffered aqueous solution
• mol peso: antigen ~42.39 kDa
• reactividad de especies: human
• técnicas: indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2aκ
• Nº de acceso NCBI: BC002526
• Nº de acceso UniProt: P34932
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... HSPA4(3308)

Descripción

Inmunógeno

HSPA4 (AAH02526, 1 a.a. ~ 148 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID

Acciones bioquímicas o fisiológicas

Hspa4 (heat shock protein family A (Hsp70) member 4) is an important ATP-dependent cytosolic chaperone along with Hsp90. Hspa4 aids in the folding of several proteins and helps in protecting against cellular stresses such as rise in temperature. Hspa4 maintains the function of the mitotic centrosome to coordinates bipolar mitotic spindle assembly. Hspa4 might compensate the loss of parkin function in mice by protecting the cells against proteolytic and mitochondrial stress. Therefore, it can serve as an important therapeutic agent for parkinson disease. Upregulation of HSPA4 is observed in parkin gene knockout mice. Hspa4 is known to be associated with tumor progression and offers resistance against many therapeutic agents. The gene is upregulated in many different types of cancer.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable