SAB1401443

Monoclonal Anti-GMPS antibody produced in mouse

clone 6B5, purified immunoglobulin, buffered aqueous solution

• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 6B5, monoclonal
• Formulario: buffered aqueous solution
• reactividad de especies: human
• técnicas: capture ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG1κ
• Nº de acceso NCBI: NM_003875
• Nº de acceso UniProt: P49915
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... GMPS(8833)

Descripción

Descripción general

In the de novo synthesis of purine nucleotides, IMP is the branch point metabolite at which point the pathway diverges to the synthesis of either guanine or adenine nucleotides. In the guanine nucleotide pathway, there are 2 enzymes involved in converting IMP to GMP, namely IMP dehydrogenase (IMPD1), which catalyzes the oxidation of IMP to XMP, and GMP synthetase, which catalyzes the amination of XMP to GMP. (provided by RefSeq)

Inmunógeno

GMPS (NP_003866, 108 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLTHGDSVDKVADGFKVVARSGNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSG

Características y beneficios

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable