Saltar al contenido
MilliporeSigma
Todas las fotos(1)

Documentos clave

SAB1401190

Sigma-Aldrich

Anti-IAPP antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

Sinónimos:

AMYLIN, DAP, IAP

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.43

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

reactividad de especies

human

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... IAPP(3375)

Descripción general

Islet, or insulinoma, amyloid polypeptide is commonly found in pancreatic islets of patients suffering diabetes mellitus type II, or harboring an insulinoma. While the assosciation of amylin with the development of type II diabetes has been known for some time, a direct causative role for amylin has been harder to establish. Studies suggest that amylin, like the related beta-amyloid (Abeta) associated with Alzheimer′s disease, can induce apoptotic cell-death in particular cultured cells, an effect that may be relevant to the development of type II diabetes. (provided by RefSeq)

Inmunógeno

IAPP (NP_000406.1, 1 a.a. ~ 89 a.a) full-length human protein.

Sequence
MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL

Acciones bioquímicas o fisiológicas

IAPP (islet amyloid polypeptide) is secreted by the pancreatic β-cells along with insulin. IAPP is known to be involved in the regulation of gastric emptying, satiety and inhibiting glucagon secretion. IAPP is associated with type 2 diabetes mellitus where IAPP is part of amyloid deposits and is associated with mass and functional loss of β-cells. Oligomers and fibrils formed by IAPP is known to be toxic to the pancreatic islet β-cells.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Influence of Aluminium and EGCG on Fibrillation and Aggregation of Human Islet Amyloid Polypeptide.
Xu ZX
Journal of Diabetes Research, 2016:1867059, 1-14 (2016)
Disease-linked mutations in factor H reveal pivotal role of cofactor activity in self-surface-selective regulation of complement activation.
Kerr H
The Journal of Biological Chemistry, 292(32), 13345-13360 (2017)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico