SAB1400775

Anti-CDCA5 antibody produced in mouse

IgG fraction of antiserum, buffered aqueous solution

• Sinónimos: Anti-MGC16386
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect immunofluorescence: suitable; western blot: 1 μg/mL
• UniProt accession no.: Q96FF9
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CDCA5(113130)

Descripción

General description

CDCA5 (cell division cycle associated 5) gene is mapped to human chromosome 11q13.1. The gene codes for the protein sororin. The protein is localized in the nucleus. It is known to be conserved among the vertebrates.

Immunogen

CDCA5 (NP_542399.1, 1 a.a. ~ 252 a.a) full-length human protein.

Sequence
MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE

Biochem/physiol Actions

Sororin regulates proper cohesion and separation of sister chromatids during replication, by stabilizing cohesin on DNA. Phosphorylation of sororin by cyclin B during mitosis, reduces its potential to prevent Wap1 (cohesin release factor) and Pds5 (cohesin-interacting protein) binding.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable