Saltar al contenido
MilliporeSigma

MSST0045

Sigma-Aldrich

SILuProt TIMP2, Metalloproteinase inhibitor 2 human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C and 15N-labeled

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

10 μG
$742.00

$742.00


Check Cart for Availability

Solicitar un pedido a granel

Seleccione un Tamaño

Cambiar Vistas
10 μG
$742.00

About This Item

Código UNSPSC:
23201100
NACRES:
NA.12

$742.00


Check Cart for Availability

Solicitar un pedido a granel

recombinante

expressed in HEK 293 cells

Nivel de calidad

Ensayo

≥98% (SDS-PAGE)

Formulario

lyophilized powder

potencia

≥98% Heavy amino acids incorporation efficiency by MS

idoneidad

suitable for mass spectrometry (standard)

Nº de acceso UniProt

temp. de almacenamiento

−20°C

Descripción general

SILuProt TIMP2 is a recombinant, stable isotope-labeled human TIMP2 which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of TIMP2 in mass-spectrometry. SILuProt TIMP2 is a protein of 194 amino acids , with a calculated molecular mass of 21.7 kDa.

Acciones bioquímicas o fisiológicas

While the mammalian TIMP family has four members, TIMP-2 is a unique family member in that in addition to inhibiting matrix metalloproteinases (MMPs), TIMP-2 selectively interacts with MT1-MMP to facilitate the cell-surface activation of pro-MMP-2.1 Thus, TIMP-2 functions both as an inhibitor of MMPs, and is required for the cellular mechanism of pro-MMP-2 activation. Recently, it was validated that combination of TIMP-2 with another urinary cell-cycle arrest biomarkers, i.e. the insulin-like growth factor-binding protein 7 (IGFBP7) may predict the risk of moderate and severe acute kidney injury (AKI) in critically ill patients. For postoperative surgical intensive care unit patients, a single urinary TIMP2•IGFBP7 test accurately identified patients at risk for developing AKI within the ensuing 12 hours and its inclusion in clinical risk prediction models significantly enhances their performance.

Secuencia

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Forma física

Supplied as a lyophilized powder containing phosphate buffered saline.

Información legal

SILu is a trademark of Sigma-Aldrich Co. LLC

Código de clase de almacenamiento

11 - Combustible Solids

Clase de riesgo para el agua (WGK)

WGK 2

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico