Saltar al contenido
MilliporeSigma
Todas las fotos(1)

Documentos clave

MSST0040

Sigma-Aldrich

SILuLite IFNG Interferon Gamma human

recombinant, expressed in HEK 293 cells, MS Protein Standard

Sinónimos:

IFNγ, IFN-gamma, Immune interferon, Immuneinterferon

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

50 μG
$742.00

$742.00


Fecha estimada de envío20 de mayo de 2025


Solicitar un pedido a granel

Seleccione un Tamaño

Cambiar Vistas
50 μG
$742.00

About This Item

Código UNSPSC:
23201100
NACRES:
NA.12

$742.00


Fecha estimada de envío20 de mayo de 2025


Solicitar un pedido a granel

origen biológico

human

Nivel de calidad

recombinante

expressed in HEK 293 cells

Ensayo

≥98% (SDS-PAGE)

Formulario

lyophilized powder

potencia

≥98% Heavy amino acids incorporation efficiency by MS

mol peso

calculated mol wt 17 kDa

técnicas

mass spectrometry (MS): suitable

idoneidad

suitable for mass spectrometry (internal calibrator)

Nº de acceso UniProt

temp. de almacenamiento

−20°C

Información sobre el gen

human ... IFNG(3458)

Descripción general

Interferon gamma (IFNγ) is a dimerized soluble cytokine that is the only member of the type II class of interferons. IFNγ is secreted by T helper cells (specifically, Th1 cells), cytotoxic T cells (TC cells) and Natural killer (NK) cells. When combined with other inflammatory cytokines, evaluating the levels of IFNγ can be used as a diagnostic tool in patients with breast cancer or benign prostatic hyperplasia. A recent study evaluated the effect of a cancer vaccine given to patients with colorectal cancer, on the levels of plasma pro-inflammatory cytokines (including IFN-γ). The study concluded that patients achieving stable disease showed increasing levels of plasma inflammatory cytokines.

Inmunógeno

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG

Acciones bioquímicas o fisiológicas

SILuLite IFNG is a recombinant human protein expressed in human 293 cells. It is a homodimer consisting of 138 amino acids Expressed in human 293 cells, with a calculated molecular mass of 17 kDa. SILu Lite IFNG is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Forma física

Lyophilized from a solution of phosphate buffered saline.

Información legal

SILu is a trademark of Sigma-Aldrich Co. LLC

Código de clase de almacenamiento

11 - Combustible Solids

Clase de riesgo para el agua (WGK)

WGK 2

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico