Saltar al contenido
MilliporeSigma
Todas las fotos(7)

Documentos

HPA043484

Sigma-Aldrich

Anti-SRSF5 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-Hrs, Anti-Serine/arginine-rich splicing factor 5, Anti-Sfrs5, Anti-Srp40

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human, rat, mouse

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

KELCSERVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTE

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SRSF5(6430)

General description

Serine and arginine rich splicing factor 5 (SRSF5) is encoded by the gene mapped to human chromosome 14. The encoded protein belongs to the SR protein family and is ubiquitously expressed.

Immunogen

serine/arginine-rich splicing factor 5 recombinant protein epitope signature tag (PrEST)

Application

Anti-SRSF5 antibody produced in rabbit has been used in immunoblotting (1:1000 dilution).

Biochem/physiol Actions

Serine and arginine rich splicing factor 5 (SRSF5) is a major splicing regulator of human immunodeficiency virus type 1 (HIV-1) mRNA. It functions as a potential diagnostic marker for small-cell lung cancer and pleural metastatic cancer. Increased expression of SRSF5 boosts lamin A mRNA production in HeLa cells and fibroblasts of patients with hutchinson gilford progeria syndrome (HGPS), which is a rare genetic disease leading to accelerated aging. Thus, this protein acts as a potential therapeutic perspective for premature aging.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST84343

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Proteasome-mediated proteolysis of SRSF5 splicing factor intriguingly co-occurs with SRSF5 mRNA upregulation during late erythroid differentiation.
Breig O and Baklouti F
PLoS ONE, 8 (2013)
SRSF5: a novel marker for small-cell lung cancer and pleural metastatic cancer.
Kim HR
Lung Cancer, 99, 57-65 (2016)
Enhanced SRSF5 Protein Expression Reinforces Lamin A mRNA Production in HeLa Cells and Fibroblasts of Progeria Patients.
Vautrot V
Human Mutation, 37, 280-291 (2016)
Won Cheol Park et al.
BMC cancer, 16, 358-358 (2016-06-11)
Serine/arginine-rich splicing factors (SRSFs) and HNRNPA1 have oncogenic properties. However, their proteomic expressions and practical priority in gastric cancer (GC) and colorectal cancer (CRC) are mostly unknown. To apply SFs in clinics, effective marker selection and characterization of properties in
Xiaoli Zhang et al.
iScience, 24(10), 103097-103097 (2021-10-09)
The serine/arginine-rich (SR) family of splicing factors plays important roles in mRNA splicing activation, repression, export, stabilization, and translation. SR-splicing factor 5 (SRSF5) is a glucose-inducible protein that promotes tumor cell growth. However, the functional role of SRSF5 in tissue

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico