Saltar al contenido
MilliporeSigma
Todas las fotos(2)

Documentos clave

HPA040361

Sigma-Aldrich

Anti-CX3CL1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-Abcd-3, Anti-C3xkine, Anti-Chemokine (c-x3-c motif) ligand 1, Anti-Cxc3, Anti-Cxc3c, Anti-Fractalkine, Anti-Neurotactin, Anti-Ntn, Anti-Scyd1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
$555.00

$555.00


Normalmente se envía en 1 semana. (Para pedidos fuera de Estados Unidos y Europa, calcule la entrega 1 o 2 semanas más tarde)


Seleccione un Tamaño

Cambiar Vistas
100 μL
$555.00

About This Item

Número MDL:
Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41

$555.00


Normalmente se envía en 1 semana. (Para pedidos fuera de Estados Unidos y Europa, calcule la entrega 1 o 2 semanas más tarde)

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

técnicas

immunohistochemistry: 1:500- 1:1000

secuencia del inmunógeno

GVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLE

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... CX3CL1(6376)

Descripción general

C-X3-C motif chemokine ligand 1(CX3CL1), also known as fractalkine (FKN), is encoded by the gene mapped to human chromosome 16q21. The encoded protein acts as a chemotactic cytokine in a soluble form, or acts as a binding molecule in a membrane-attached form. CX3CL1 is characterized by a mucin-like stalk containing chemokine domain and single transmembrane domain with a short intracellular C-terminal. CX3CL1 belongs to the CX3C chemokine subfamily.

Inmunógeno

chemokine (C-X3-C motif) ligand 1 recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-CX3CL1 antibody produced in rabbit has been used in tissue microarray (TMA) immunostaining.[1]

Acciones bioquímicas o fisiológicas

CX3CL1 interacts with its cognate receptor CX3CR1 and stimulates chemotaxis of macrophages to apoptotic lymphocytes. The protein also facilitates inflammatory processes in the central nervous system (CNS). CX3CL1 has been implicated in the molecular mechanism that controls cell adhesion, migration and survival of human prostate cancer cells. Hence, the protein has potential therapeutic approach to treatment of prostate cancer. Elevated expression of serum CX3CL1 has been observed in postmenopausal osteoporotic patients. Thus, it acts as a potential diagnostic marker and therapeutic target for anti-resorptive treatment in osteoporosis patients.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST81765

Forma física

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Lucy A Truman et al.
Blood, 112(13), 5026-5036 (2008-09-19)
Cells undergoing apoptosis are efficiently located and engulfed by phagocytes. The mechanisms by which macrophages, the professional scavenging phagocytes of apoptotic cells, are attracted to sites of apoptosis are poorly defined. Here we show that CX3CL1/fractalkine, a chemokine and intercellular
WangMi Liu et al.
Archivum immunologiae et therapiae experimentalis, 64(5), 371-383 (2016-04-22)
Chemokines are a family of small 8-10 kDa inducible cytokines. Initially characterized as chemotactic factors, they are now considered to affect not just cellular recruitment. CX3CL1 is a unique chemokine that can exist in a soluble form, as a chemotactic cytokine
Yi-Ding Chen et al.
British journal of biomedical science, 73(3), 121-128 (2016-08-02)
The chemokine (C-X3-C motif) ligand 1 (CX3CL1), also called fractalkine (FKN), has recently been reported to be involved in osteoclastogenic process and pathological bone destruction. This study aimed to investigate the link between serum CX3CL1/FKN levels with disease progression of
Gladys Morrison et al.
Stem cell research, 16(1), 140-148 (2016-01-17)
Differentiated cells retain the genetic information of the donor but the extent to which phenotypic differences between donors or batches of differentiated cells are explained by variation introduced during the differentiation process is not fully understood. In this study, we
Jiebing Tang et al.
Oncology reports, 35(2), 1153-1162 (2016-01-01)
Epithelial-to-mesenchymal transition (EMT) endows cancer cells with enhanced invasive and metastatic potential during cancer progression. Fractalkine, also known as chemokine (C-X3-C motif) ligand 1 (CX3CL1), the only member recognized so far that belongs to the CX3C chemokine subfamily, was reported

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico