Saltar al contenido
MilliporeSigma
Todas las fotos(2)

Documentos clave

HPA026797

Sigma-Aldrich

Anti-DGKQ antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-DAGK, Anti-DAGK4, Anti-DAGK7, Anti-diacylglycerol kinase

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
$520.26

$520.26

Precio de catálogo$598.00Ahorre 13 %

Normalmente se envía en 1 semana. (Para pedidos fuera de Estados Unidos y Europa, calcule la entrega 1 o 2 semanas más tarde)


Seleccione un Tamaño

Cambiar Vistas
100 μL
$520.26

About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41

$520.26

Precio de catálogo$598.00Ahorre 13 %

Normalmente se envía en 1 semana. (Para pedidos fuera de Estados Unidos y Europa, calcule la entrega 1 o 2 semanas más tarde)

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

técnicas

immunohistochemistry: 1:20- 1:50

secuencia del inmunógeno

HVSLFVGGLPPGLSPEEYSSLLHEAGATKATVVSVSHIYSSQGAVVLDVACFAEAERLYMLLKDMAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSG

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... DGKQ(1609)

Descripción general

Diacylglycerol kinase θ (DGKθ) of 941 amino acids with molecular mass of ~ 110 kDa is encoded by a gene mapped to human chromosome 4p16.3. DGKθ, also known as diacylglycerol kinase 4 (DAGK4), belongs to group V of DGK protein family. It is characterized with three cysteine-rich domains, N-terminal proline/ glycine-rich domain, a pleckstrin homology domain and Ras-associating domain.[1] DGKθ needs polybasic cofactor and acidic phospholipids for its absolute activity. DGKθ is highly expressed in brain and at low level in the small intestine, duodenum and liver.

Inmunógeno

diacylglycerol kinase, theta 110kDa recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-DGKQ antibody produced in rabbit has been used in western blotting.[1] All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Acciones bioquímicas o fisiológicas

Diacylglycerol kinase theta (DGKθ) plays a vital role in synthesizing phosphatidic acid (PA) ligand for the nuclear receptor steroidogenic factor 1 (SF1) and functions in the regulation of adrenocortical steroidogenesis. DGKθ expression is essential for SF1/cAMP (cyclic adenosine monophosphate) stimulated CYP17A1 (Cytochrome P450 17A1) transcription and it also promotes steroid hormone production in human adrenocortical cells.[1]

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST86847

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Mammalian diacylglycerol kinases, a family of lipid kinases with signaling functions.
Topham MK, Prescott SM
The Journal of Biological Chemistry, 274(17), 11447-11450 (1999)
Assignment of the human diacylglycerol kinase 4 (DAGK4) gene to chromosome 4p16.3.
Endele S
Genomics, 33(1), 145-146 (1996)
Cloning of a novel human diacylglycerol kinase (DGKtheta) containing three cysteine-rich domains, a proline-rich region, and a pleckstrin homology domain with an overlapping Ras-associating domain.
Houssa B
The Journal of Biological Chemistry, 272(16), 10422-10428 (1997)
Becky Tu-Sekine et al.
The Journal of biological chemistry, 287(50), 41619-41627 (2012-10-24)
Diacylglycerol kinases are important mediators of lipid signaling cascades, and insight into their regulation is of increasing interest. Using purified DGK-θ, we show that this isoform is subject to dual regulation and that the previously characterized stimulation by acidic phospholipids
Kai Cai et al.
Journal of lipid research, 54(8), 2121-2132 (2013-04-24)
Diacylglycerol kinase (DGK)θ is a lipid kinase that phosphorylates diacylglycerol to form phosphatidic acid (PA). We have previously shown that PA is a ligand for the nuclear receptor steroidogenic factor 1 (SF1) and that cAMP-stimulated expression of SF1 target genes

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico