HPA011209

Anti-FGF4 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-FGF-4, Anti-Fibroblast growth factor 4 precursor, Anti-HBGF-4, Anti-HST, Anti-HST-1, Anti-Heparin secretory-transforming protein, Anti-Transforming protein KS3
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA011209
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• validación mejorada: recombinant expression; Learn more about Antibody Enhanced Validation
• técnicas: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:20-1:50
• secuencia del inmunógeno: VVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFL
• Nº de acceso UniProt: P08620
• aplicaciones: research pathology
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... FGF4(2249)

Descripción

Descripción general

FGF4 (fibroblast growth factor 4) is a part of FGF family of secreted signaling proteins. FGF family consists of 22 heparin-binding polypeptides. FGF4 conforms in to the β-trefoil fold like other FGF members, and consists of a signal peptide. It was first identified in the screening of Kaposi′s sarcoma and human stomach cancers. This protein is made of 206 amino acids, and contains an N-glycosylation site. This gene is expressed during gastrula and early somite stage embryos, in proximity to the posterior endoderm. In the gut endoderm, it shows an anterior-posterior expression pattern. In adult humans, it is expressed in nervous system, intestines and testis. It is located on human chromosome 11q13.

Inmunógeno

Fibroblast growth factor 4 precursor recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Acciones bioquímicas o fisiológicas

FGF4 (fibroblast growth factor 4) plays an important role in embryogenesis, and is involved in the patterning and survival of embryo. It is responsible for the activation of IIIc splice forms of FGFR1 to 3 by binding to them. Its expression in the initial stages is essential for the successful formation of induced pluripotent stem cells (iPSCs). This is achieved by the interaction of Artd1 (ADP-ribosyltransferase Diphtheria Toxin-like 1) and Sox2 (SRY (sex determining region Y)-box 2), which regulate reprogramming of cells. FGF4 regulates the development of stromal layers in both normal conditions and in acute myeloid leukemia. This gene is involved in spermatogenesis, and is up-regulated in testicular cancers. It has a protective action against adriamycin-induced testicular toxicity.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST71534

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)