Saltar al contenido
MilliporeSigma
Todas las fotos(2)

Documentos clave

HPA004940

Sigma-Aldrich

Anti-AATF antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-BFR2, Anti-CHE-1, Anti-CHE1, Anti-DED

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
$598.00

$598.00


Check Cart for Availability


Seleccione un Tamaño

Cambiar Vistas
100 μL
$598.00

About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.43

$598.00


Check Cart for Availability

origen biológico

rabbit

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

técnicas

immunohistochemistry: 1:50- 1:200

secuencia del inmunógeno

SVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKALLTSLVGLQ

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... AATF(26574)

Descripción general

Apoptosis antagonizing transcription factor (AATF) is a 73kDa nuclear phosphoprotein, which is made of 523 amino acids. Human AATF consists of a leucine zipper, many phosphorylation sites, putative nuclear localization signal- NLS1 and NLS2 and three motifs, which bind to nuclear receptors. The leucine zipper lies within residues 239- 260, and putative NLS within residues 300 and 467. AATF has an acidic N- terminal domain with two very acidic regions from residues 20-49 and 107-170, and these regions are separated by a Ser/Thr-rich domain. AATF is also known as Che-1, and in humans, it is located on chromosome 17q11.2-q12.

Inmunógeno

Protein AATF recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-AATF antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Acciones bioquímicas o fisiológicas

AATF was initially identified to interact with DAP like kinase (Dlk) and it interferes with Dlk- induced apoptosis. AATF has an essential role in the early steps of embryogenesis. It also interacts with transcription factors as an adaptor to promote transcription. AATF is activated by ER (endoplasmic reticulum) stress through PERK signalling, which in turn activates v-akt murine thymoma viral oncogene homolog 1 (AKT1) via STAT3, leading to cell survival and cell resistance to ER stress. AATF and Wolfram syndrome 1 (WFS1) genes have also been shown to crosstalk, and therefore deficiencies in either gene mediate apoptosis in Wolfram syndrome. [1] AATF might also act as a neuroprotective agent as its suppression by Aβ protein in cortical neuronal cells increases Aβ toxicity in these cells. AATF also interacts with Par-4 (prostate apoptosis response-4) and prevents the aberrant production of Aβ-42 peptide by Par-4.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST86928

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

AATF protects neural cells against oxidative damage induced by amyloid beta-peptide.
Xie J and Guo Q
Neurobiology of Disease, 16(1), 150-157 (2004)
The anti-apoptotic factor Che-1/AATF links transcriptional regulation, cell cycle control, and DNA damage response.
Passananti C and Fanciulli M
Cell Division, 2, 21-21 (2007)
G Page et al.
FEBS letters, 462(1-2), 187-191 (1999-12-02)
Dlk, also known as ZIP kinase, is a serine/threonine kinase that is tightly associated with nuclear structures. Under certain conditions, which require cytoplasmic localization, Dlk can induce apoptosis. In search for interaction partners that might serve as regulators or targets
Qing Guo et al.
The Journal of biological chemistry, 279(6), 4596-4603 (2003-11-25)
Aggregation of the neurotoxic amyloid beta peptide 1-42 (Abeta-(1-42)) in the brain is considered to be an early event in the pathogenesis of Alzheimer's disease (AD). Par-4 (prostate apoptosis response-4) is a leucine zipper protein that is pro-apoptotic and associated
S Ishigaki et al.
Cell death and differentiation, 17(5), 774-786 (2009-11-17)
Endoplasmic reticulum (ER) stress-mediated cell death has an important role in the pathogenesis of chronic diseases, including diabetes and neurodegeneration. Although proapoptotic programs activated by ER stress have been extensively studied, identification and characterization of antiapoptotic programs that counteract ER

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico