Saltar al contenido
MilliporeSigma

HPA002111

Sigma-Aldrich

ANTI-KDM6A antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-UTX, Anti-Ubiquitously transcribed TPR protein on the X chromosome, Anti-Ubiquitously transcribed X chromosome tetratricopeptide repeat protein

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
$471.75

$471.75

Precio de catálogo$555.00Ahorre 15 %

Fecha estimada de envío17 de abril de 2025



Seleccione un Tamaño

Cambiar Vistas
100 μL
$471.75

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

$471.75

Precio de catálogo$555.00Ahorre 15 %

Fecha estimada de envío17 de abril de 2025


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... UTX(7403)

General description

Lysine-specific demethylase 6A (KDM6A) is a tumor suppressor gene mapped to human chromosome Xp11.3. The gene codes for histone H3 lysine 27 (H3K27) demethylase, which is a member of the switch/sucrose non-fermentable (SWI/SNF) family.

Immunogen

Ubiquitously transcribed X chromosome tetratricopeptide repeat protein (Ubiquitously transcribed TPR protein on the X chromosome)

Sequence
IGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHT

Application

ANTI-KDM6A antibody produced in rabbit has been used in western blotting and immunoprecipitation.

Biochem/physiol Actions

Lysine-specific demethylase 6A (KDM6A) counteracts zeste homolog 2 (EZH2) function and induces tumor suppression by stimulating gene transcription of E-cadherin, cell cycle regulators and tumor-suppressing subchromosomal transferable fragments. It also eliminates trimethylation marks from histone 3 lysine 27 (H3K27) and supports histone demethylase activity through its catalytic JmjC domain. Mutation in the gene leads to the development of a rare congenital anomaly syndrome, Kabuki syndrome (KS).

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST85171

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Inhibition of EZH2 induces NK cell-mediated differentiation and death in muscle-invasive bladder cancer
Ramakrishnan S, et al.
Cell Death and Differentiation, 26(10), 2100-2114 (2019)
Histone demethylase KDM6A controls the mammary luminal lineage through enzyme-independent mechanisms
Yoo K, et al.
Molecular and Cellular Biology, 36(16), 2108-2120 (2016)
Novel KDM6A splice-site mutation in kabuki syndrome with congenital hydrocephalus: a case report
Guo Z, et al.
BMC Medical Genetics, 19(1), 206-206 (2018)
Epigenetic regulation of epithelial-mesenchymal transition by KDM6A histone demethylase in lung cancer cells
Terashima M, et al.
Biochemical and Biophysical Research Communications, 490(4), 1407-1413 (2017)
Kyung Hyun Yoo et al.
Molecular and cellular biology, 36(16), 2108-2120 (2016-05-25)
Establishment of the mammary luminal cell lineage is controlled primarily by hormones and through specific transcription factors (TFs). Previous studies have linked histone methyltransferases to the differentiation of mammary epithelium, thus opening the possibility of biological significance of counteracting demethylases.

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico