Saltar al contenido
MilliporeSigma
Todas las fotos(2)

Documentos clave

AV50600

Sigma-Aldrich

Anti-SENP6 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-FLJ11355, Anti-FLJ11887, Anti-KIAA0389, Anti-KIAA0797, Anti-SSP1, Anti-SUMO1/Sentrin specific peptidaSe 6, Anti-SUSP1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
$541.00

$541.00


Normalmente se envía en 5 días laborables. (Para pedidos fuera de Estados Unidos, calcule la entrega 1 o 2 semanas más tarde)


Seleccione un Tamaño

Cambiar Vistas
100 μL
$541.00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

$541.00


Normalmente se envía en 5 días laborables. (Para pedidos fuera de Estados Unidos, calcule la entrega 1 o 2 semanas más tarde)

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

125 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SENP6(26054)

Descripción general

SENP6 is a SUMO-deconjugating enzyme that negatively modulates TLR-mediated inflammatory signaling[1]. Studies have reported that SENP6 also regulates PML nuclear bodies and is required for inner kinetochore assembly.
Rabbit Anti-SENP6 antibody recognizes human SENP6.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human SENP6

Aplicación

Rabbit Anti-SENP6 antibody is suitable for western blot applications at a concentration of 1μg/ml.

Acciones bioquímicas o fisiológicas

SENP6 is a UBL-specific protease that deconjugates SUMO1, SUMO2 and SUMO3 from targeted proteins. It does not seem to be involved in the processing of full-length SUMO proteins to their mature forms. SENP6 deconjugates SUMO1 from RXRA, leading to transcriptional activation. It may act preferentially on substrates containing 3 or more SUMO2 or SUMO3 moieties.Ubiquitin-like molecules (UBLs), such as SUMO1 (UBL1; MIM 601912), are structurally related to ubiquitin (MIM 191339) and can be ligated to target proteins in a similar manner as ubiquitin. However, covalent attachment of UBLs does not result in degradation of the modified proteins. SUMO1 modification is implicated in the targeting of RANGAP1 (MIM 602362) to the nuclear pore complex, as well as in stabilization of I-kappa-B-alpha (NFKBIA; MIM 164008) from degradation by the 26S proteasome. Like ubiquitin, UBLs are synthesized as precursor proteins, with 1 or more amino acids following the C-terminal glycine-glycine residues of the mature UBL protein. Thus, the tail sequences of the UBL precursors need to be removed by UBL-specific proteases, such as SENP6, prior to their conjugation to target proteins (Kim et al., 2000 [PubMed 10799485]).[supplied by OMIM].

Secuencia

Synthetic peptide located within the following region: MNLANWFPPPRMRTKREEIRNIILKLQEDQSKEKRKHKDTYSTEAPLGEG

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Xing Liu et al.
PLoS pathogens, 9(6), e1003480-e1003480 (2013-07-05)
The signaling of Toll-like receptors (TLRs) induces host defense against microbial invasion. Protein posttranslational modifications dynamically shape the strength and duration of the signaling pathways. It is intriguing to explore whether de-SUMOylation could modulate the TLR signaling. Here we identified
Debaditya Mukhopadhyay et al.
The Journal of cell biology, 188(5), 681-692 (2010-03-10)
We have analyzed the mitotic function of SENP6, a small ubiquitin-like modifier (SUMO) protease that disassembles conjugated SUMO-2/3 chains. Cells lacking SENP6 showed defects in spindle assembly and metaphase chromosome congression. Analysis of kinetochore composition in these cells revealed that
Neil Hattersley et al.
Molecular biology of the cell, 22(1), 78-90 (2010-12-15)
Promyelocytic leukemia protein (PML) is the core component of PML-nuclear bodies (PML NBs). The small ubiquitin-like modifier (SUMO) system (and, in particular, SUMOylation of PML) is a critical component in the formation and regulation of PML NBs. SUMO protease SENP6

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico