AV50505
Anti-AIM2 antibody produced in rabbit
affinity isolated antibody
Sinónimos:
Anti-Absent in melanoma 2, Anti-PYHIN4
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
origen biológico
rabbit
conjugado
unconjugated
forma del anticuerpo
affinity isolated antibody
tipo de anticuerpo
primary antibodies
clon
polyclonal
Formulario
buffered aqueous solution
mol peso
39 kDa
reactividad de especies
human, horse
concentración
0.5 mg - 1 mg/mL
técnicas
western blot: suitable
Nº de acceso NCBI
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... AIM2(9447)
Descripción general
The gene AIM2 (Absent in melanoma 2) is mapped to human chromosome 1q22. It belongs to the IFI20X /IFI16 family. AIM2 transcripts are detected in spleen, small intestine, testis and peripheral blood leukocytes.
Inmunógeno
Synthetic peptide directed towards the N terminal region of human AIM2
Aplicación
Anti-AIM2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Acciones bioquímicas o fisiológicas
Absent in melanoma 2 (AIM2) is induced by IFN-γ. The probable roles of AIM2 are regulation of cell proliferation, inflammation and benign prostate hyperplasia. It also suppresses proliferation and tumorigenicity of human breast cancer cells. AIM2 is a suppressor of melanoma tumorigenicity. AIM2 is up-regulated in humans with hepatitis B virus-associated glomerulonephritis. AIM2 expression was positively correlated with caspase-1 and IL (Interleukin)-1β expression. AIM2 is also a component of inflammasome and can sense cytoplasmic DNA, causing activation of ASC (apoptosis-associated speck-like protein containing a CARD) pyroptosome and caspase-1.
Secuencia
Synthetic peptide located within the following region: ESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATL
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
12 - Non Combustible Liquids
Clase de riesgo para el agua (WGK)
WGK 3
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
Lot/Batch Number
¿No ve la versión correcta?
Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Larissa Ponomareva et al.
Molecular cancer research : MCR, 11(10), 1193-1202 (2013-07-19)
Close links have been noted between chronic inflammation of the prostate and the development of human prostatic diseases such as benign prostate hyperplasia (BPH) and prostate cancer. However, the molecular mechanisms that contribute to prostatic inflammation remain largely unexplored. Recent
I-Fen Chen et al.
Molecular cancer therapeutics, 5(1), 1-7 (2006-01-25)
IFN-inducible proteins are known to mediate IFN-directed antitumor effects. The human IFN-inducible protein absent in melanoma 2 (AIM2) gene encodes a 39-kDa protein, which contains a 200-amino-acid repeat as a signature of HIN-200 family (hematopoietic IFN-inducible nuclear proteins). Although AIM2
K L DeYoung et al.
Oncogene, 15(4), 453-457 (1997-07-24)
Chromosome 6-mediated suppression of tumorigenicity in malignant melanoma cell lines provides a model system to identify genes associated with the reversion of the tumorigenic phenotype. Using subtractive cDNA selection, we recently identified a series of novel genes which are differentially
Junhui Zhen et al.
Mediators of inflammation, 2014, 190860-190860 (2014-04-05)
AIM2 plays an important role in innate immunity, but its role in regulating the immune response to hepatitis B virus (HBV) is unknown. We hypothesized that AIM2 expression is positively correlated with HBV-mediated inflammation in patients with HBV-associated glomerulonephritis (HBV-GN)
Teresa Fernandes-Alnemri et al.
Nature, 458(7237), 509-513 (2009-01-23)
Host- and pathogen-associated cytoplasmic double-stranded DNA triggers the activation of a NALP3 (also known as cryopyrin and NLRP3)-independent inflammasome, which activates caspase-1 leading to maturation of pro-interleukin-1beta and inflammation. The nature of the cytoplasmic-DNA-sensing inflammasome is currently unknown. Here we
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico