Saltar al contenido
MilliporeSigma
Todas las fotos(1)

Documentos clave

AV50137

Sigma-Aldrich

Anti-ABHD13 (AB1) antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-Abhydrolase domain containing 13, Anti-BEM46L1, Anti-C13orf6, Anti-FLJ14906, Anti-MGC27058, Anti-RP11-153I24.2, Anti-bA153I24.2

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

38 kDa

reactividad de especies

horse, human, dog

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... ABHD13(84945)

Descripción general

The gene ABHD13 (α/β hydrolase domain-containing protein 13) is mapped to human chromosome 13q33.3.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human ABHD13

Aplicación

Anti-ABHD13 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Acciones bioquímicas o fisiológicas

The α/β hydrolase fold domain (ABHD) family proteins are suggested to be involved in lipid synthesis and degradation. Copy number variations in ABHD13 are detected in humans suffering from rolandic epilepsies.

Secuencia

Synthetic peptide located within the following region: SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGN

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Sarra Dimassi et al.
Epilepsia, 55(2), 370-378 (2014-01-01)
Rolandic epilepsies (REs) represent the most frequent epilepsy in childhood. Patients may experience cognitive, speech, language, reading, and behavioral issues. The genetic origin of REs has long been debated. The participation of rare copy number variations (CNVs) in the pathophysiology
Caleb C Lord et al.
Biochimica et biophysica acta, 1831(4), 792-802 (2013-01-19)
Dysregulation of lipid metabolism underlies many chronic diseases such as obesity, diabetes, cardiovascular disease, and cancer. Therefore, understanding enzymatic mechanisms controlling lipid synthesis and degradation is imperative for successful drug discovery for these human diseases. Genes encoding α/β hydrolase fold

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico