Saltar al contenido
MilliporeSigma
Todas las fotos(1)

Documentos clave

AV49753

Sigma-Aldrich

Anti-FNDC3B antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-DKFZp686D14170, Anti-DKFZp762K137, Anti-FAD104, Anti-FLJ23399, Anti-Fibronectin type III domain containing 3B, Anti-MGC10002, Anti-PRO4979, Anti-YVTM2421

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

44 kDa

reactividad de especies

rabbit, horse, rat, dog, human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

NP_001128567

Nº de acceso UniProt

Q53EP0

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... FNDC3B(64778)

Categorías relacionadas

Inmunógeno

Synthetic peptide directed towards the N terminal region of human FNDC3B

Aplicación

Anti-FNDC3B antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Acciones bioquímicas o fisiológicas

Fibronectin type III domain containing 3B (FNDC3B; FAD104) is a positive regulator of adipogenesis and is highly expressed in the early stage of adipogenesis. FNDC3B gene is reportedly associated with primary open-angle glaucoma.

Secuencia

Synthetic peptide located within the following region: RARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPP

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number
QC19303

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

Busque por un COA

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Kei Tominaga et al.
FEBS letters, 577(1-2), 49-54 (2004-11-06)
A novel gene named fad104 (factor for adipocyte differentiation-104), whose expression level quickly increased in the early stage of adipogenesis, was isolated and characterized. The deduced amino acid sequence of fad104 revealed the possible presence of a fibronectin type III
Yi Lu et al.
Nature genetics, 45(2), 155-163 (2013-01-08)
Central corneal thickness (CCT) is associated with eye conditions including keratoconus and glaucoma. We performed a meta-analysis on >20,000 individuals in European and Asian populations that identified 16 new loci associated with CCT at genome-wide significance (P < 5 ×

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico