Synthetic peptide directed towards the N terminal region of human FNDC3B
Application
Anti-FNDC3B antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.
Biochem/physiol Actions
Fibronectin type III domain containing 3B (FNDC3B; FAD104) is a positive regulator of adipogenesis and is highly expressed in the early stage of adipogenesis. FNDC3B gene is reportedly associated with primary open-angle glaucoma.
Sequence
Synthetic peptide located within the following region: RARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPP
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
A novel gene named fad104 (factor for adipocyte differentiation-104), whose expression level quickly increased in the early stage of adipogenesis, was isolated and characterized. The deduced amino acid sequence of fad104 revealed the possible presence of a fibronectin type III
Central corneal thickness (CCT) is associated with eye conditions including keratoconus and glaucoma. We performed a meta-analysis on >20,000 individuals in European and Asian populations that identified 16 new loci associated with CCT at genome-wide significance (P < 5 ×
Questions
Reviews
★★★★★ No rating value
Active Filters
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.