AV49489
Anti-FAM20C (AB1) antibody produced in rabbit
affinity isolated antibody
Sinónimos:
Anti-DMP4, Anti-Family with sequence similarity 20, member C, Anti-RNS
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
Productos recomendados
origen biológico
rabbit
conjugado
unconjugated
forma del anticuerpo
affinity isolated antibody
tipo de anticuerpo
primary antibodies
clon
polyclonal
Formulario
buffered aqueous solution
mol peso
66 kDa
reactividad de especies
rat, guinea pig, rabbit, dog, mouse, human, horse
concentración
0.5 mg - 1 mg/mL
técnicas
western blot: suitable
Nº de acceso NCBI
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... FAM20C(56975)
Descripción general
FAM20C (Family with sequence similarity 20, member C) is a member of FAM20 protein family. It is distributed in several mammalian cell lines. During hematopoietic differentiation, it is expressed in hematopoietic cells.
Inmunógeno
Synthetic peptide directed towards the middle region of human FAM20C
Aplicación
Anti-FAM20C (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Acciones bioquímicas o fisiológicas
FAM20C (Family with sequence similarity 20, member C) is a secretory Golgi casein kinase involved in biomineralization, enamel formation, lipid homeostasis, wound healing, cell migration and adhesion. It has the ability to phosphorylate S-x-E/pS motifs on proteins in milk and in the extracellular matrix of bones and teeth. During enamel formation, it forms a functional complex by binding to a pseudokinase, Fam20A, which triggers extracellular protein phosphorylation within the secretory pathway. Mutations in FAM20C gene cause Raine syndrome, hypophosphatemia, hyperphosphaturia, dental anomalies, intracerebral calcifications and osteosclerosis.
Secuencia
Synthetic peptide located within the following region: CFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSY
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
12 - Non Combustible Liquids
Clase de riesgo para el agua (WGK)
WGK 3
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
Lot/Batch Number
¿No ve la versión correcta?
Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Exome sequencing reveals FAM20c mutations associated with fibroblast growth factor 23-related hypophosphatemia, dental anomalies, and ectopic calcification.
Rafaelsen SH, et al.
Journal of Bone and Mineral Research, 28, 1378-1385 (2013)
Hypophosphatemic osteomalacia and bone sclerosis caused by a novel homozygous mutation of the FAM20C gene in an elderly man with a mild variant of Raine syndrome.
Takeyari S, et al.
Bone, 67, 56-62 (2014)
Vincent S Tagliabracci et al.
Cell, 161(7), 1619-1632 (2015-06-20)
The existence of extracellular phosphoproteins has been acknowledged for over a century. However, research in this area has been undeveloped largely because the kinases that phosphorylate secreted proteins have escaped identification. Fam20C is a kinase that phosphorylates S-x-E/pS motifs on
Demet Nalbant et al.
BMC genomics, 6, 11-11 (2005-01-29)
Hematopoiesis is a complex developmental process controlled by a large number of factors that regulate stem cell renewal, lineage commitment and differentiation. Secreted proteins, including the hematopoietic growth factors, play critical roles in these processes and have important biological and
Jixin Cui et al.
eLife, 4, e06120-e06120 (2015-03-20)
Although numerous extracellular phosphoproteins have been identified, the protein kinases within the secretory pathway have only recently been discovered, and their regulation is virtually unexplored. Fam20C is the physiological Golgi casein kinase, which phosphorylates many secreted proteins and is critical
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico