AV49019

Anti-GLYATL2 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-BXMAS2-10, Anti-GATF-B, Anti-Glycine-N-acyltransferase-like 2, Anti-MGC24009
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 34 kDa
• reactividad de especies: human
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_659453
• Nº de acceso UniProt: Q8WU03
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... GLYATL2(219970)

Descripción

Inmunógeno

Synthetic peptide directed towards the middle region of human GLYATL2

Aplicación

Anti-GLYATL2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Acciones bioquímicas o fisiológicas

Glycine-N-acyltransferase-like 2 (GLYATL2) is an enzyme associated with the endoplasmic reticulum and expressed in spinal cord, trachea, thyroid and salivary glands. This enzyme is involved in conjugation of the CoA ester of fatty acids to glycine.

Secuencia

Synthetic peptide located within the following region: LDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNK

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable