Saltar al contenido
MilliporeSigma
Todas las fotos(1)

Documentos clave

AV48498

Sigma-Aldrich

Anti-TTC6 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-MGC119358, Anti-MGC119360, Anti-MGC119361, Anti-Tetratricopeptide repeat domain 6

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

59 kDa

reactividad de especies

human, rabbit, mouse, horse, dog, bovine, pig

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... TTC6(115669)

Descripción general

TTC6 codes for tetratricopeptide repeat domain 6 protein. It has been identified as a susceptibility locus for allergic diseases.
Rabbit Anti-TTC6 antibody recognizes human, canine, and mouse TTC6.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human TTC6

Aplicación

Rabbit Anti-TTC6 antibody is suitable for western blot applications at a concentration of 0.5μg/ml.

Acciones bioquímicas o fisiológicas

The functions of TTC6 remain unknown.

Secuencia

Synthetic peptide located within the following region: MKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEY

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

David A Hinds et al.
Nature genetics, 45(8), 907-911 (2013-07-03)
Allergic disease is very common and carries substantial public-health burdens. We conducted a meta-analysis of genome-wide associations with self-reported cat, dust-mite and pollen allergies in 53,862 individuals. We used generalized estimating equations to model shared and allergy-specific genetic effects. We

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico