Saltar al contenido
MilliporeSigma
Todas las fotos(1)

Documentos clave

AV48015

Sigma-Aldrich

Anti-DKK1 antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-DKK-1, Anti-Dickkopf homolog 1 (Xenopus laevis), Anti-SK

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203

origen biológico

rabbit

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

lyophilized powder

mol peso

26 kDa

reactividad de especies

pig, guinea pig, bovine, horse, rabbit, zebrafish, sheep, human, rat, goat, canine, mouse

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

temp. de almacenamiento

−20°C

Información sobre el gen

human ... DKK1(22943)

Descripción general

Dickkopf WNT signaling pathway inhibitor 1 (DKK1) may be involved in embryonic development. Studies in aortic endothelial cells have revealed that Dkk1 modulates endothelial-mesenchymal cells. Downregulation of DKK1 has been linked to colorectal tumorigenesis. Serum DKK1 has been identified has a diagnostic biomarker for hepatocellular carcinoma.
Rabbit Anti-DKK1 antibody recognizes bovine, chicken, zebrafish, pig, canine, mouse, rat, human, and rabbit DKK1.

Inmunógeno

The immunogen for anti-DKK1 antibody: synthetic peptide derected towards the C terminal of human DKK1

Aplicación

Rabbit Anti-DKK1 antibody is suitable for western blot applications at a concentration of 2.5μg/ml

Secuencia

Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD

Forma física

Lyophilized from PBS buffer with 2% sucrose

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Qiujin Shen et al.
The Lancet. Oncology, 13(8), 817-826 (2012-06-29)
Hepatocellular carcinoma (HCC) is prevalent worldwide and improvements in timely and effective diagnosis are needed. We assessed whether measurement of Dickkopf-1 (DKK1) in serum could improve diagnostic accuracy for HCC. We analysed data for patients with HCC, chronic hepatitis B
Su-Li Cheng et al.
Arteriosclerosis, thrombosis, and vascular biology, 33(7), 1679-1689 (2013-05-21)
Endothelial cells (ECs) can undergo an endothelial-mesenchymal transition with tissue fibrosis. Wnt- and Msx2-regulated signals participate in arteriosclerotic fibrosis and calcification. We studied the impact of Wnt7, Msx2, and Dkk1, a Wnt7 antagonist, on endothelial-mesenchymal transition in primary aortic ECs.
Zebin Huang et al.
PloS one, 8(7), e70077-e70077 (2013-08-08)
We collected paired samples of tumor and adjacent normal colorectal tissues from 22 patients with colorectal carcinoma to compare the differences in the expression of lysine specific demethylase 1 (LSD1) in these two tissues. The results showed that in 19

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico