Saltar al contenido
MilliporeSigma
Todas las fotos(2)

Documentos clave

AV46385

Sigma-Aldrich

Anti-ST3GAL5 antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-SIAT9, Anti-SIATGM3S, Anti-ST3 β-galactoside α-2,3-sialyltransferase 5, Anti-ST3GalV

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

IgG fraction of antiserum

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

48 kDa

reactividad de especies

human, rabbit, horse, rat, pig, mouse

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... ST3GAL5(8869)

Inmunógeno

Synthetic peptide directed towards the N terminal region of human ST3GAL5

Aplicación

Anti-ST3GAL5 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml. It is also useful for immunohistochemistry at a concentration of 4-8μg/ml.

Acciones bioquímicas o fisiológicas

ST3GAL5 (ST3 beta-galactoside alpha-2,3-sialyltransferase 5) gene also known as SIAT9, SIATGM3S, ST3GalV or GM3 synthase encodes for a Golgi type II membrane protein belongs to the glycosyltransferase family 29. ST3GAL5 plays a crucial role in the formation of GM3 using lactosylceramide as the substrate. Loss of function mutation in the ST3GAL5, encoding GM3 synthase results in incapability to synthesize alpha and beta series of gangliosides that may cause infantile epilepsy syndrome.

Secuencia

Synthetic peptide located within the following region: DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Michael A Simpson et al.
Nature genetics, 36(11), 1225-1229 (2004-10-27)
We identified an autosomal recessive infantile-onset symptomatic epilepsy syndrome associated with developmental stagnation and blindness. Assuming a founder effect in a large Old Order Amish pedigree, we carried out a genome-wide screen for linkage and identified a single region of
M L Allende et al.
Glycobiology, 10(10), 1025-1032 (2000-10-13)
Ganglioside GM2 synthase and other enzymes required for complex ganglioside synthesis were localized recently to the trans Golgi network (TGN). However, there are conflicting reports as to the location of GM3 synthase; originally this enzyme was detected in the early

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico