Saltar al contenido
MilliporeSigma
Todas las fotos(4)

Documentos clave

AV45437

Sigma-Aldrich

Anti-TAPBP antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-NGS17, Anti-TAP binding protein (tapasin), Anti-TAPA, Anti-TPN, Anti-TPSN

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(4)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

46 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

NP_003181

Nº de acceso UniProt

O15533

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

Información sobre el gen

human ... TAPBP(6892)

Categorías relacionadas

Inmunógeno

Synthetic peptide directed towards the C terminal region of human TAPBP

Aplicación

Anti-TAPBP antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Acciones bioquímicas o fisiológicas

TAP binding protein (TAPBP; tapasin) is a membrane glycoprotein that is involved in the transport of antigenic peptides across the endoplasmic membrane. The expression of tapasin is upregulated by potent inflammatory molecules such as eicosanoids. Downregulation of tapasin expression is associated with clinical outcome in primary human oral squamous cell carcinoma. Polymorphisms in TAPBP gene have been associated with the overall survival of colorectal cancer patients.

Secuencia

Synthetic peptide located within the following region: GEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHS

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number
QC15524

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

Busque por un COA

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Jiaofang Shao et al.
PloS one, 8(8), e70307-e70307 (2013-08-14)
Recent studies have demonstrated the power of deep re-sequencing of the whole genome or exome in understanding cancer genomes. However, targeted capture of selected genomic whole gene-body regions, rather than the whole exome, have several advantages: 1) the genes can
Sung-hwan Cho et al.
Pharmacogenetics and genomics, 23(7), 341-348 (2013-06-06)
Aspirin-exacerbated respiratory disease (AERD) is characterized by the development of airway obstruction in asthmatic individuals following the ingestion of aspirin or other nonsteroidal anti-inflammatory drugs. TAPBP (TAP-binding protein, tapasin) is upregulated by eicosanoids, which act as potent inflammatory molecules in
Qian Jiang et al.
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine, 31(5), 451-459 (2010-06-10)
MHC class I peptide loading complex defects are frequently observed in tumor cells which facilitate tumor cells escaping from immune surveillance. Tapasin plays an important role in the assembly of MHC class I molecules with peptides in the endoplasmic reticulum.

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico