AV42237

Anti-IDH3A antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-Isocitrate dehydrogenase 3 (NAD⁺) α
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 40 kDa
• species reactivity: mouse, rat, human, horse, dog, rabbit, bovine, guinea pig
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• NCBI accession no.: NP_005521
• UniProt accession no.: P50213
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... IDH3A(3419)

Descripción

Immunogen

Synthetic peptide directed towards the N terminal region of human IDH3A

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Biochem/physiol Actions

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. IDH3A is the alpha subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase.Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the alpha subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase.

Sequence

Synthetic peptide located within the following region: MKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable