AV39623

Anti-CBLL1 antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-Cas-Br-M (murine) ecotropic retroviral transforming sequence-like 1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 55 kDa
• reactividad de especies: bovine, rat, human, mouse, horse, dog
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_079090
• Nº de acceso UniProt: Q75N03
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• Información sobre el gen: human ... CBLL1(79872)

Descripción

Descripción general

CBLL1 (Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase) is a cbl-like ubiquitin ligase of E-cadherin complex. It is expressed in the neurons of central nervous system.[1][2]
Rabbit Anti-CBLL1 antibody recognizes human, mouse, rat, zebrafish, canine, and chicken CBLL1.

Inmunógeno

Synthetic peptide directed towards the C terminal region of human CBLL1

Aplicación

Rabbit Anti-CBLL1 antibody is suitable for western blot applications at a concentration of 1.25μg/ml.

Acciones bioquímicas o fisiológicas

CBLL1 (Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase) is an E-cadherin binding protein involved in the ubiquitination of E-cadherin and regulation of E-cadherin complex endocytosis. During ubiquitination, it directly binds to the cytoplasmic domain of E-cadherin. It has been reported in a study that CBLL1 may play a role in neuronal apoptosis and in LPS (Lipopolysaccharide) administration. CBLL1 also have been predicted as a regulator of cell proliferation.[1][2]

Secuencia

Synthetic peptide located within the following region: PFTQPGGMSPGIWPAPRGPPPPPRLQGPPSQTPLPGPHHPDQTRYRPYYQ

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable