AV39473
Anti-LZTS1 antibody produced in rabbit
IgG fraction of antiserum
Sinónimos:
Anti-Leucine zipper, putative tumor suppressor 1
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
67 kDa
species reactivity
horse, rat, guinea pig, mouse, bovine, human
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
Gene Information
human ... LZTS1(11178)
General description
Leucine zipper, putative tumor suppressor 1 (LZTS1) is a protein that regulates the molecular events involved in progression of cells through the M phase of mitosis. It functions as a tumor suppressor for a range of major cancer histotypes, such as bladder cancer and urothelial carcinomas. LZTS1 is transiently expressed at the border of the ventricular and mantle zones in subsets of sensory and motor spinal neurons.
Specificity
Anti-LZTS1 polyclonal antibody reacts with human, mouse, rat, bovine, and canine leucine zipper, putative tumor suppressor 1 proteins.
Immunogen
Synthetic peptide directed towards the C terminal region of human LZTS1
Application
Anti-LZTS1 polyclonal antibody is used to tag leucine zipper, putative tumor suppressor 1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of leucine zipper, putative tumor suppressor 1 as a tumor suppressor gene and mediator of M-phase cell cycle progression.
Biochem/physiol Actions
Leucine zipper putative tumor suppressor 1 (LZTS1) is a tumor suppressor gene involved in the cell growth activity. It is down-regulated in several human malignancies. It retards the growth in cancer cells by regulating the mitotic process. It restricts Cdk1 (Cyclin-Dependent Kinase 1) activity by steadying the Cdc25C (cell division cycle 25C) phosphatase, a mitotic activator of Cdk1. Deregulation of this gene is associated with breast cancer and may serve as a prognostic factor for breast cancer therapy. It is found to be down-regulated by promoter methylation. This gene is found to be involved in ovarian carcinogenesis.
Sequence
Synthetic peptide located within the following region: QQSYVAMYQRNQRLEKALQQLARGDSAGEPLEVDLEGADIPYEDIIATEI
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Herramienta de selección de productos.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Francesca Lovat et al.
Oncotarget, 5(4), 970-977 (2014-01-23)
The Leucine Zipper Tumor Suppressor 1 (LZTS1) is a tumor suppressor gene, located at chromosome 8p22, which is frequently altered in human cancer. In normal tissue, its ubiquitous expression regulates cell mitosis by the stabilization of microtubule networks. LZTS1-deficient mouse
Andrea Vecchione et al.
Cancer cell, 11(3), 275-289 (2007-03-14)
The FEZ1/LZTS1 (LZTS1) protein is frequently downregulated in human cancers of different histotypes. LZTS1 is expressed in normal tissues, and its introduction in cancer cells inhibits cell growth and suppresses tumorigenicity, owing to an accumulation of cells in G2/M. Here
H Ishii et al.
Proceedings of the National Academy of Sciences of the United States of America, 96(7), 3928-3933 (1999-03-31)
Alterations of human chromosome 8p occur frequently in many tumors. We identified a 1.5-Mb common region of allelic loss on 8p22 by allelotype analysis. cDNA selection allowed isolation of several genes, including FEZ1. The predicted Fez1 protein contained a leucine-zipper
Ling Chen et al.
Breast cancer research and treatment, 116(3), 471-478 (2008-08-08)
FEZ1/LZTS1 is a tumor suppressor gene located in chromosomal band 8p22, and methylation has been identified as a mechanism for its loss of function in tumors. Chromosomal deletion at 8p22 is also frequent in breast cancer. We therefore examined whether
Daniela Califano et al.
Journal of cellular physiology, 222(2), 382-386 (2009-11-04)
The FEZ1/LZTS1 (FEZ1) gene maps to chromosome 8p22 and is frequently altered in human cancer. FEZ1 has been proposed as a candidate tumour suppressor gene and its loss may contribute to tumour progression. We have analysed the expression of FEZ1
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico