Saltar al contenido
MilliporeSigma
Todas las fotos(3)

Documentos clave

AV38933

Sigma-Aldrich

Anti-STAT1 (AB3) antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-DKFZp686B04100, Anti-ISGF-3, Anti-STAT91, Anti-Signal transducer and activator of transcription 1, 91 kDa

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
$541.00

$541.00

Normalmente se envía en 5 días laborables. (Para pedidos fuera de Estados Unidos, calcule la entrega 1 o 2 semanas más tarde)
Todas las fotos(3)

Seleccione un Tamaño

Cambiar Vistas
100 μL
$541.00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

$541.00

Normalmente se envía en 5 días laborables. (Para pedidos fuera de Estados Unidos, calcule la entrega 1 o 2 semanas más tarde)

origen biológico

rabbit

Nivel de calidad

100

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

87 kDa

reactividad de especies

horse, human, guinea pig, rat, mouse, rabbit, dog

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

NP_644671

Nº de acceso UniProt

P42224

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... STAT1(6772)

Categorías relacionadas

Inmunógeno

Synthetic peptide directed towards the N terminal region of human STAT1

Acciones bioquímicas o fisiológicas

Signal transducers and activators of transcription (STAT) are a group of proteins that mediate a wide range of cellular functions by activation of gene transcription. STAT1 is activated by IFG-γ, IFN-α, PDGF and IL-6. It acts with important signaling pathways mediated by JAK and MAPK to mediate inflammation and cell viability in response to pathogens and cell stimuli. STAT1 expression levels have prognostic value in in specific types of breast cancer.

Secuencia

Synthetic peptide located within the following region: MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDV

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number
QC8957

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

Busque por un COA

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Antonis E Koromilas et al.
JAK-STAT, 2(2), e23353-e23353 (2013-09-24)
The anti-tumor function of STAT1 through its capacity to control the immune system and promote tumor immune surveillance has been well understood. However, little is known about cell autonomous (i.e., tumor cell-specific) functions of STAT1 in tumor formation. Recent studies
Nancy Au-Yeung et al.
JAK-STAT, 2(3), e23931-e23931 (2013-09-27)
STAT1 and STAT2 proteins are key mediators of type I and type III interferon (IFN) signaling, and are essential components of the cellular antiviral response and adaptive immunity. They associate with IFN regulatory factor 9 (IRF9) to form a heterotrimeric
Isabella Rauch et al.
JAK-STAT, 2(1), e23820-e23820 (2013-09-24)
Interferons (IFN) are subdivided into type I IFN (IFN-I, here synonymous with IFN-α/β), type II (IFN-γ) and type III IFN (IFN-III/IFN-λ) that reprogram nuclear gene expression through STATs 1 and 2 by forming STAT1 dimers (mainly IFN-γ) or the ISGF3
Shihao Chen et al.
Frontiers in microbiology, 11, 603131-603131 (2020-12-29)
Avian leukosis virus subgroup J (ALV-J), an oncogenic retrovirus, is known to cause immunosuppression and various types of cancer in chickens. Recent reports have shown that epigenetic changes in DNA and chromatin are widely implicated in the life cycle of
Yao-Tsung Yeh et al.
International journal of cancer, 118(12), 2943-2947 (2006-01-21)
Although it is known that STAT3 transcriptional activity is modulated by phosphorylation at serine residue 727, the role of STAT3 serine phosphorylation in breast cancer remains mostly unexplored. In this study, we examined the expression patterns of serine residue 727-phosphorylated
Ver todos los artículos relacionados

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico