AV37665

Anti-GPC3 antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-Glypican 3
• UNSPSC Code: 12352203

Propiedades

• biological source: rabbit
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: lyophilized powder
• mol wt: 64 kDa
• species reactivity: guinea pig, horse, canine, rat, mouse, rabbit, bovine, human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_004475
• UniProt accession no.: P51654
• storage temp.: −20°C
• Gene Information: human ... GPC3(2719)

Descripción

General description

Glypican 3 (GPC3), whose gene is associated with Simpson-Golabi-Behmel syndrome, is a heparin sulfate proteoglycan that is anchored to cell-surfaces via glycosylphosphatidylinositol (GPI). Overexpression of glypican 3 occurs in hepatocellular carcinomas (HCC). The silencing of glypican 3 expression leads to apoptosis in HCC.

Specificity

Anti-GPC3 polyclonal antibody reacts with canine, bovine, human, mouse, and rat glypican 3 proteins.

Immunogen

The immunogen for anti-GPC3 antibody: synthetic peptide derected towards the middle region of human GPC3

Application

Anti-GPC3 polyclonal antibody is used to tag glypican 3 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe in cancer diagnosis to detect the presence of glypican 3 in hepatocellular carcinomas (HCC).

Sequence

Synthetic peptide located within the following region: FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL

Physical form

Lyophilized from PBS buffer with 2% sucrose

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 12 - Non Combustible Liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable