Saltar al contenido
MilliporeSigma
Todas las fotos(1)

Documentos clave

AV35650

Sigma-Aldrich

Anti-SLC18A1 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-Solute carrier family 18 (vesicular monoamine), member 1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
$541.00

$541.00


Normalmente se envía en 5 días laborables. (Para pedidos fuera de Estados Unidos, calcule la entrega 1 o 2 semanas más tarde)


Seleccione un Tamaño

Cambiar Vistas
100 μL
$541.00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

$541.00


Normalmente se envía en 5 días laborables. (Para pedidos fuera de Estados Unidos, calcule la entrega 1 o 2 semanas más tarde)

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

56 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... SLC18A1(6570)

Inmunógeno

Synthetic peptide directed towards the N terminal region of human SLC18A1

Acciones bioquímicas o fisiológicas

Solute carrier family 18 (vesicular monoamine), member 1 (SLC18A1) is a vesicular monamine transporter that is involved in the transport of monoamine neurotransmitters. It accumulates cytosolic monoamines into vesicles based on the proton gradient. Variations in SLC18A1 transporter have been observed in neuropsychiatric disorders.

Secuencia

Synthetic peptide located within the following region: MNDTASTIPPPATEAISAHKNNCLQGTGFLEEEITRVGVLFASKAVMQLL

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 2

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Falk W Lohoff et al.
Neuropsychopharmacology : official publication of the American College of Neuropsychopharmacology, 31(12), 2739-2747 (2006-08-29)
The vesicular monoamine transporter 1 gene (VMAT1/SLC18A1) maps to the shared bipolar disorder (BPD)/schizophrenia (SZ) susceptibility locus on chromosome 8p21. Vesicular monoamine transporters are involved in transport of monoamine neurotransmitters which have been postulated to play a relevant role in
Ahmed M Khalifa et al.
Neuro endocrinology letters, 33(5), 546-551 (2012-10-24)
Although single nucleotide polymorphisms of the human vesicular monoamine transporter 1 (hVMAT1) gene SLC18A1 have been associated with neuropsychiatric disorders, there is limited information on the function of naturally occurring hVMAT1 variant proteins. This study evaluated transport activity of full

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico