AV32759

Anti-HMG20A (AB2) antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-FLJ10739, Anti-HMGX1, Anti-High-mobility group 20A
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 40 kDa
• species reactivity: mouse, rat, dog, guinea pig, horse, human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_060670
• UniProt accession no.: Q9NP66
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... HMG20A(10363)

Descripción

General description

HMG20A is a homeobox gene that is expressed ubiquitously. Studies in CHO-K1 cells have reported that it interacts with the poxvirus protein, CP77, and modulates its dissociation from the genome of vaccinia virus.
Rabbit Anti-HMG20A (AB2) antibody recognizes bovine, human, mouse, rat, and canine HMG20A.

Immunogen

Synthetic peptide directed towards the middle region of human HMG20A

Application

Rabbit Anti-HMG20A (AB2) antibody can be used for western blot applications at 1.25 μg/ml.

Biochem/physiol Actions

HMG20A plays a role in neuronal differentiation as chromatin-associated protein. HMG20A acts as inhibitor of HMG20B. HMG20A overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. HMG20A involved in the recruitment of the histone methyltransferase MLL and consequent increased methylation of histone H3 lysine 4

Sequence

Synthetic peptide located within the following region: RKTQDRQKGKSHRQDAARQATHDHEKETEVKERSVFDIPIFTEEFLNHSK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable