Saltar al contenido
MilliporeSigma
Todas las fotos(3)

Documentos clave

AV32738

Sigma-Aldrich

Anti-MyEF2 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-Myelin expression factor 2

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

64 kDa

reactividad de especies

dog, rat, human, rabbit, mouse, bovine, horse, guinea pig

concentración

0.5 mg - 1 mg/mL

técnicas

immunohistochemistry: suitable
western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... MYEF2(50804)

Descripción general

Myelin basic protein (MBP) is a major component of the myelin sheath whose production is developmentally controlled during myelinogenesis. Myelin expression factor 2 (MyEF2), a single-stranded DNA binding factor, is a repressor of myelin basic protein (MBP) expression. MyEF2 interacts with RUNX1 to represses hematopoietic genes in erythroid cells.
Rabbit polyclonal anti-MyEF2 antibody reacts with bovine, canine, human, mouse, rat, zebrafish, and chicken myelin expression factor 2 proteins.

Inmunógeno

Synthetic peptide directed towards the middle region of human MYEF2

Aplicación

Rabbit Anti-MyEF2 can be used for western blot (1 μg/ml) and IHC (4-8 μg/ml) applications.
Rabbit polyclonal anti-MyEF2 antibody is used to tag myelin expression factor 2 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of myelin expression factor 2 in the repression of genes involved in myelinogenesis and hematopoiesis.

Acciones bioquímicas o fisiológicas

MEF-2 is expressed early in the differentiation program and is suppressed by specific polypeptide growth factors. The ability of MEF-2 to recognize conserved activating elements associated with multiple-specific genes suggests that this factor may participate in the coordinate regulation of genes during myogenesis.

Secuencia

Synthetic peptide located within the following region: QAGRLGSTIFVANLDFKVGWKKLKEVFSIAGTVKRADIKEDKDGKSRGMG

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Boet van Riel et al.
Molecular and cellular biology, 32(19), 3814-3822 (2012-07-18)
RUNX1 is known to be an essential transcription factor for generating hematopoietic stem cells (HSC), but much less is known about its role in the downstream process of hematopoietic differentiation. RUNX1 has been shown to be part of a large
V Muralidharan et al.
Journal of cellular biochemistry, 66(4), 524-531 (1997-09-15)
Myelin basic protein (MBP) is a major component of the myelin sheath whose production is developmentally controlled during myelinogenesis. Earlier studies have indicated that programmed expression of the MBP gene is regulated at the level of transcription. Evidently, the MB1

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico