AV31638

Anti-ELF2 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-E74-like factor 2 (ets domain transcription factor)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 57 kDa
• reactividad de especies: bovine, rat, horse, rabbit, human, guinea pig, mouse, dog
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_973728
• Nº de acceso UniProt: Q15723-3
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... ELF2(1998)

Descripción

Descripción general

ELF2 is a transcription factor that belongs to the Eph ligand family of proteins. This transcription factor is known to be expressed in the hind brain and newly forming somites of the mouse embryo.
Rabbit Anti-ELF2 antibody recognizes chicken, human, mouse, rat, and canine ELF2.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human ELF2

Aplicación

Rabbit Anti-ELF2 antibody can be used for western blot assays at concentration of 0.5μg/ml.

Acciones bioquímicas o fisiológicas

The ELF2 gene encodes a protein that physically interacts with AML1 and mediates opposing effects on AML1-mediated transcription of the B cell-specific blk gene.

Secuencia

Synthetic peptide located within the following region: TSPDSHEPMKKKKVGRKPKTQQSPISNGSPELGIKKKPREGKGNTTYLWE

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable