AV31526

Anti-SUPT16H antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-CDC68, Anti-FACT, Anti-FACTP140, Anti-FLJ10857, Anti-FLJ14010, Anti-FLJ34357, Anti-SPT16/CDC68, Anti-Suppressor of Ty 16 homolog (S. cerevisiae)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 66 kDa
• reactividad de especies: rabbit, rat, human, pig, horse, dog
• concentración: 0.5 mg - 1 mg/mL
• técnicas: western blot: suitable
• Nº de acceso NCBI: NP_009123
• Nº de acceso UniProt: Q9Y5B9
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... SUPT16H(11198)

Descripción

Descripción general

SUPT16H is a transcription factor that interacts with RNF40. This transcription factor mediates structural changes in chromatin during DNA double strand repair.
Rabbit Anti-SUPT16H antibody recognizes bovine, rat, human, zebrafish, mouse, and canine SUPT16H.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human SUPT16H

Aplicación

Rabbit Anti-SUPT16H antibody can be used for western blot assays at a concentration of 1.25μg/ml.

Acciones bioquímicas o fisiológicas

Transcription of protein-coding genes can be reconstituted on naked DNA with only the general transcription factors and RNA polymerase II. However, this minimal system cannot transcribe DNA packaged into chromatin, indicating that accessory factors may facilitate access to DNA. One such factor, FACT (facilitates chromatin transcription), interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT is composed of an 80 kDa subunit and a 140 kDa subunit, the latter of which is SUPT16H.

Secuencia

Synthetic peptide located within the following region: ASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDKMIEAIK

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable