AV31438

Anti-GTF2H3 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-General transcription factor IIH, polypeptide 3, 34 kDa
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• mol peso: 34 kDa
• reactividad de especies: rat, human, mouse, rabbit, pig, horse
• concentración: 0.5 mg - 1 mg/mL
• técnicas: immunohistochemistry: suitable; western blot: suitable
• Nº de acceso NCBI: NP_001507
• Nº de acceso UniProt: Q13889
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... GTF2H3(2967)

Descripción

Descripción general

GTF2H3 belongs to the TFB4 family of transcription factors and forms a part of the TFIIH complex. GTF2H3 regulates nucleotide excision repair and RNA polymerase II-mediated transcription.
Rabbit Anti-GTF2H3 antibody recognizes bovine, human, mouse, and rat GTF2H3.

Inmunógeno

Synthetic peptide directed towards the N terminal region of human GTF2H3

Aplicación

Rabbit Anti-GTF2H3 antibody can be used for western blot (2μg/ml) and immunohistochemistry (4-8μg/ml) assays.

Acciones bioquímicas o fisiológicas

GTranscription Factor Antibodies2H3 interacts with HIV-1 Tat as a component of the HIV-1 transcription pre-initiation complex, but is released from the elongation complex which includes P-TEFb. It synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter.

Secuencia

Synthetic peptide located within the following region: VIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSAN

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 3
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable