AV30060

Anti-ZNF512 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-Zinc finger protein 512
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 65 kDa
• species reactivity: bovine, guinea pig, human, horse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_115810
• UniProt accession no.: Q96ME7
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... ZNF512(84450)

Descripción

General description

ZNF512 is a protein that may have four zinc finger motifs that probably interact with nucleic acid or proteins. Rabbit Anti-ZNF512 antibody binds to bovine, human, mouse, and rat ZNF512.

Immunogen

Synthetic peptide directed towards the middle region of human ZNF512

Application

Rabbit Anti-ZNF512 antibody can be used for western blot (0.5μg/ml) applications.

Biochem/physiol Actions

ZNF512 is a new candidate transcription factor.

Sequence

Synthetic peptide located within the following region: QLRSLAGMKYHVMANHNSLPILKAGDEIDEPSERERLRTVLKRLGKLRCM

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable