Saltar al contenido
MilliporeSigma
Todas las fotos(1)

Documentos clave

AV09001

Sigma-Aldrich

Anti-DOK1 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-Docking protein 1, 62 kDa (downstream of tyrosine kinase 1), Anti-MGC117395, Anti-MGC138860, Anti-P62DOK

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
$541.00

$541.00


Normalmente se envía en 5 días laborables. (Para pedidos fuera de Estados Unidos, calcule la entrega 1 o 2 semanas más tarde)


Seleccione un Tamaño

Cambiar Vistas
100 μL
$541.00

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

$541.00


Normalmente se envía en 5 días laborables. (Para pedidos fuera de Estados Unidos, calcule la entrega 1 o 2 semanas más tarde)

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

53 kDa

reactividad de especies

human

concentración

0.5 mg - 1 mg/mL

técnicas

western blot: suitable

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... DOK1(1796)

Inmunógeno

Synthetic peptide directed towards the C terminal region of human DOK1

Aplicación

Anti-DOK1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 μg/ml.

Acciones bioquímicas o fisiológicas

DOK1 is a tumor suppressor protein that is repressed by hypermethylation in a variety of human tumors. DOK1 transcription is regulated by E2F1 transcription factor and is important during cellular stress and etoposide-induced DNA damage. DOK1 is the critical mediator of stress-induced cell death. Inactivation of DOK1 is a frequent feature in head and neck cancers.

Secuencia

Synthetic peptide located within the following region: EPGTATGSGIKSHNSALYSQVQKSGASGSWDCGLSRVGTDKTGVKSEGST

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Amandine Saulnier et al.
International journal of cancer, 130(11), 2484-2494 (2011-07-29)
The DOK1 gene is a putative tumour suppressor gene located on the human chromosome 2p13 which is frequently rearranged in leukaemia and other human tumours. We previously reported that the DOK1 gene can be mutated and its expression down-regulated in
Maha Siouda et al.
Molecular and cellular biology, 32(23), 4877-4890 (2012-10-03)
The expression of the tumor suppressor DOK1 is repressed in a variety of human tumors as a result of hypermethylation of its promoter region. However, the molecular mechanisms by which DOK1 expression is regulated have been poorly investigated. Here, we

Questions

Reviews

No rating value

Active Filters

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico