HPA014518

Anti-P2RY12 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(s): Anti-HORK3, Anti-P2Y12, Anti-SP1999
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA014518
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• enhanced validation: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• technique(s): immunohistochemistry: 1:1000-1:2500
• immunogen sequence: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
• UniProt accession no.: Q9H244
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... P2RY12(64805)

Description

General description

Purinergic receptor P2Y G protein-coupled 12 (P2RY12) is encoded by the gene mapped to human chromosome 3q25.1. The encoded protein belongs to the family of P2 purinergic receptors. P2RY12 is characterized with seven transmembrane G protein coupled receptors (GPCRs) that contributes to ATP-and ADP-mediated cell migration in vitro. The protein is expressed in activated platelets and microglial cells.

Immunogen

purinergic receptor P2Y, G-protein coupled, 12

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collecation of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-P2RY12 antibody produced in rabbit has been used in immunohistochemistry.

Biochem/physiol Actions

Purinergic receptor P2Y G protein-coupled 12 (P2RY12) interacts with its ligand ADP and gets activated. This activated receptor plays a vital role in increasing the platelet responses that underlie arterial thrombosis and associated inflammation. P2RY12 is also involved in maintaining thrombus stability in-vivo.Mutation in the gene is associated with the development of ADP receptor deficiency and blood pressure-related disorders. Inhibition of P2RY12 is considered to be a potent therapeutic method for treating pathologic bone loss.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72771

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1