Skip to Content
Merck
All Photos(3)

Key Documents

SAB1412644

Sigma-Aldrich

ANTI-ATF3 antibody produced in mouse

clone 7G10, purified immunoglobulin, buffered aqueous solution

Synonym(s):

ATF3

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

7G10, monoclonal

form

buffered aqueous solution

mol wt

antigen 45.65 kDa

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG1κ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ATF3(467)

General description

Activating transcription factor 3 (ATF3) is encoded by the gene mapped to human chromosome 1q. It belongs to the ATF/cAMP response element binding (CREB) family of transcription factors. The encoded protein contains a basic region involved in specific DNA binding, and a leucine zipper (bZIP) motif responsible for forming homodimers or heterodimers with other bZIP-containing proteins. ATF3 protein is expressed at low levels in normal and quiescent cells, but its expression is triggered on exposure to extracellular signals such as, growth factors, cytokines and some genotoxic stress agents.
Activating transcription factor 3 is a member of the mammalian activation transcription factor/cAMP responsive element-binding (CREB) protein family of transcription factors. Multiple transcript variants encoding two different isoforms have been found for this gene. The longer isoform represses rather than activates transcription from promoters with ATF binding elements. The shorter isoform (deltaZip2) lacks the leucine zipper protein-dimerization motif and does not bind to DNA, and it stimulates transcription presumably by sequestering inhibitory co-factors away from the promoter. It is possible that alternative splicing of the ATF3 gene may be physiologically important in the regulation of target genes. (provided by RefSeq)

Immunogen

ATF3 (AAH06322, 1 a.a. ~ 181 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS

Biochem/physiol Actions

Activating transcription factor 3 (ATF3) plays a vital role as a novel neuronal marker of nerve injury in the nervous system. ATF3 negatively regulates toll-like receptors (TLR)-stimulated inflammatory response. The encoded protein possibly plays an essential role in homeostasis, wound healing, cell adhesion, cancer cell invasion, apoptosis and signaling pathways. Over-expression of this protein stops cell cycle progression. Increased expression of ATF3 on exposure to stress signals or DNA damage, is regulated by various signaling pathway including, p53-dependent and -independent pathways, and may also involve mitogen-activated protein (MAP) kinase signaling pathways.
ATF3 plays bifurcated roles in cancer development by stimulating apoptosis in the untransformed MCF10A (a breast cancer progression cell line) mammary epithelial cells and also conserve aggressive MCF10CA1a cells and promotes its cell motility.

Physical form

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

T Hai et al.
Gene expression, 7(4-6), 321-335 (1999-08-10)
The purpose of this review is to discuss ATF3, a member of the ATF/CREB family of transcription factors, and its roles in stress responses. In the introduction, we briefly describe the ATF/CREB family, which contains more than 10 proteins with
H Tsujino et al.
Molecular and cellular neurosciences, 15(2), 170-182 (2000-02-16)
Activating transcription factor 3 (ATF3), a member of ATF/CREB family of transcription factors, is induced in a variety of stressed tissue. ATF3 regulates transcription by binding to DNA sites as a homodimer or heterodimer with Jun proteins. The purpose of
Matthew R Thompson et al.
Journal of molecular medicine (Berlin, Germany), 87(11), 1053-1060 (2009-08-26)
Activating transcription factor 3 (ATF3) is a member of the ATF/cyclic AMP response element-binding (ATF/CREB) family of transcription factors. It is an adaptive-response gene that participates in cellular processes to adapt to extra- and/or intracellular changes, where it transduces signals
X Yin et al.
Oncogene, 27(15), 2118-2127 (2007-10-24)
Activating transcription factor 3 (ATF3) is a member of the ATF/cyclic AMP response element-binding family of transcription factors. We present evidence that ATF3 has a dichotomous role in cancer development. By both gain- and loss-of-function approaches, we found that ATF3
Mark Gilchrist et al.
Nature, 441(7090), 173-178 (2006-05-12)
The innate immune system is absolutely required for host defence, but, uncontrolled, it leads to inflammatory disease. This control is mediated, in part, by cytokines that are secreted by macrophages. Immune regulation is extraordinarily complex, and can be best investigated

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service