Skip to Content
Merck
All Photos(3)

Key Documents

HPA036561

Sigma-Aldrich

Anti-SCLT1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-FLJ30655, Anti-HCAP-1A, Anti-Sodium channel and clathrin linker 1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

KTQAVELWQTVSQELDRLHKLYQEHMTEAQIHVFESQKQKDQLFDFQQLTKQLHVTNENMEVTNQQFLKTVTEQSVIIE

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SCLT1(132320)

General description

Sodium channel and clathrin linker 1 (SCLT1)/clathrin-associated protein-1A (CAP-1A) is an important protein that has distinct domains. It is expressed in DRG (dorsal root ganglion) neurons. SCLT1 gene is located on human chromosome 4q28.2.

Immunogen

sodium channel and clathrin linker 1 recombinant protein epitope signature tag (PrEST)

Application

Anti-SCLT1 antibody has been used in immunostaining and indirect immunofluorescence.

Biochem/physiol Actions

The domains of sodium channel and clathrin linker 1 (SCLT1)/clathrin-associated protein-1A (CAP-1A) has the ability to bind and form a multiprotein complex with Na(v)1.8 and clathrin. Lack of SCLT1 results in cystic kidney. It induces membrane docking and is essential for ciliogenesis.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST79787

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Analysis of LRRC45 indicates cooperative functions of distal appendages at early steps of ciliogenesis.
Kurtulmus B, et al.
bioRxiv, 205625-205625 (2017)
Satoshi Katagiri et al.
Scientific reports, 8(1), 16733-16733 (2018-11-15)
Senior Løken syndrome (SLS) is a heterogeneous disorder characterized by severe retinal degenerations and juvenile-onset nephronophthisis. Genetic variants in ten different genes have been reported as the causes of SLS. Clinical evaluation of a patient with SLS and her unaffected
Sclt1 deficiency causes cystic kidney by activating ERK and STAT3 signaling.
Li J, et al.
Human Molecular Genetics, 26(15), 2949-2960 (2017)
Confirmation that mutations in DDX59 cause an autosomal recessive form of oral-facial-digital syndrome: Further delineation of the DDX59 phenotype in two new families.
Faily S, et al.
European Journal of Medical Genetics, 60(10), 527-532 (2017)
CAP-1A is a novel linker that binds clathrin and the voltage-gated sodium channel Nav1. 8
Liu C, et al.
Molecular and Cellular Neurosciences, 28(4), 636-649 (2005)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service