Skip to Content
Merck
All Photos(4)

Documents

HPA030867

Sigma-Aldrich

Anti-ADAM12 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-ADAM metallopeptidase domain 12, Anti-ERBB, Anti-ERBB1, Anti-MCMPMltna, Anti-MLTN

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

immunogen sequence

LLFTNKKTTIEKLRCVRPSRPPRGFQPCQAHLGHLGKGLMRKPPDSYPPKDNPRRLLQCQNVDISRPLN

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ADAM12(8038)

General description

ADAM12 (metallopeptidase domain 12) gene is mapped in human chromosome 10q26.2. ADAM12 is highly expressed in placenta. The gene encodes for two variant proteins, a full-length membrane-bound isoform (ADAM12L) and a truncated secreted variant (ADAM12S).

Immunogen

ADAM metallopeptidase domain 12 recombinant protein epitope signature tag (PrEST)

Application

ADAM12 has been used to create antibody suspension bead array to study affinity-based profiling of serum and plasma by microarray assays.
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

ADAM12 (metallopeptidase domain 12) is a metalloprotease disintegrin and catalyzes cell context-dependent cleavage of transmembrane receptors, growth factor precursors, or adhesion molecules. Abnormal expression of the gene is mostly observed in many human cancers including breast, colon, hepatocellular carcinomas, glioblastomas, stomach, oral cavity, bladder, lung and giant cell tumors of bone. ADAM12 might be associated with tumor progression, metastasis, or therapy resistance. The encoded protein serves as a marker for chemoresistance in estrogen receptor-negative tumors. ADAM12 has the ability to induce cancer stem cell phenotype in breast cancer cells. Increased expression of this gene is observed during epithelial-to-mesenchymal transition, associated with claudin-low breast tumors. Upregulation of the gene is observed in small cell lung cancer.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST77731

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

The Disintegrin and Metalloprotease ADAM12 Is Associated with TGF-?-Induced Epithelial to Mesenchymal Transition.
Ruff M
PLoS ONE, 10(9) (2015)
Phenotypic diversity of breast cancer-related mutations in metalloproteinase-disintegrin ADAM12.
Qi Y
PLoS ONE, 9(3) (2014)
Metalloprotease-disintegrin ADAM12 actively promotes the stem cell-like phenotype in claudin-low breast cancer.
Duhachek-Muggy S
Molecular Cancer, 16(1), 32-32 (2017)
Ikrame Naciri et al.
Nucleic acids research, 47(7), 3407-3421 (2019-02-13)
The proper tissue-specific regulation of gene expression is essential for development and homeostasis in metazoans. However, the illegitimate expression of normally tissue-restricted genes-like testis- or placenta-specific genes-is frequently observed in tumors; this promotes transformation, but also allows immunotherapy. Two important
ADAM12-directed ectodomain shedding of E-cadherin potentiates trophoblast fusion.
Aghababaei M
Cell Death and Differentiation, 22(12), 1970-1984 (2015)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service