Skip to Content
Merck
All Photos(3)

Key Documents

HPA007567

Sigma-Aldrich

Anti-ROCK1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Renal carcinoma antigen NY-REN-35, Anti-Rho-associated protein kinase 1, Anti-Rho-associated, coiled- coil-containing protein kinase 1, Anti-p160 ROCK-1, Anti-p160ROCK

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human, rat, mouse

enhanced validation

RNAi knockdown
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

TQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAESEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEEANSMLTKDIEILRRENEELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERT

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

General description

ROCK (Rho-associated, coiled-coil containing protein kinase) has two isoforms, ROCK1 and ROCK2 that share 65% sequence similarity. ROCK has three domains that include the N-terminal catalytic domain (CAT), a middle coiled-coil domain that mediates homodimerization, and Rho-binding (RB) and pleckstrin homology (PH) domains (RB/PH domain) at the C-terminus. The RB/PH domain acts as an autoinhibitory domain and suppresses the kinase activity of CAT. ROCK1 (Rho-associated, coiled-coil containing protein kinase 1) gene encodes a 160kDa serine/threonine kinase that specifically binds to GTP-bound Rho. It is a platelet protein with 1354 amino acids. It has a Ser/Thr kinase domain in its N-terminus, followed by a 600 amino acid long coiled-coil structure. The C-terminal region contains a cysteine-rich zinc finger-like motif and a pleckstrin homology region.

Immunogen

Rho-associated protein kinase 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

ROCK1 (Rho-associated, coiled-coil containing protein kinase 1), an effector of the small GTPase Rho, functions along with the small GTPase Rho in phosphorylating LIM-kinase 1, which in turn phosphorylates cofilin, an actin-depolymerizing factor, thereby regulating actin cytoskeletal reorganization. It is capable of inducing Ca2+-independent contraction of smooth muscle. Activation of ROCK1 by cleavage with caspase-3 stimulates the formation of membrane bleb formation in apoptotic cells. It phosphorylates and regulates zipper-interacting protein kinase (ZIPK) that mediates Ca2+-independent phosphorylation of both smooth muscle and non-muscle myosin.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86424

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Laura Hagerty et al.
The Journal of biological chemistry, 282(7), 4884-4893 (2006-12-13)
Zipper-interacting protein kinase (ZIPK) regulates Ca(2+)-independent phosphorylation of both smooth muscle (to regulate contraction) and non-muscle myosin (to regulate non-apoptotic cell death) through either phosphorylation and inhibition of myosin phosphatase, the myosin phosphatase inhibitor CPI17, or direct phosphorylation of myosin
Alexandra Zanin-Zhorov et al.
Journal of immunology (Baltimore, Md. : 1950), 198(10), 3809-3814 (2017-04-09)
Targeted inhibition of Rho-associated kinase (ROCK)2 downregulates the proinflammatory T cell response while increasing the regulatory arm of the immune response in animals models of autoimmunity and Th17-skewing human cell culture in vitro. In this study, we report that oral
J E Van Eyk et al.
The Journal of biological chemistry, 273(36), 23433-23439 (1998-08-29)
Abnormal smooth muscle contraction may contribute to diseases such as asthma and hypertension. Alterations to myosin light chain kinase or phosphatase change the phosphorylation level of the 20-kDa myosin regulatory light chain (MRLC), increasing Ca2+ sensitivity and basal tone. One
K Ohashi et al.
The Journal of biological chemistry, 275(5), 3577-3582 (2000-02-01)
LIM-kinase 1 (LIMK1) phosphorylates cofilin, an actin-depolymerizing factor, and regulates actin cytoskeletal reorganization. LIMK1 is activated by the small GTPase Rho and its downstream protein kinase ROCK. We now report the site of phosphorylation of LIMK1 by ROCK. In vitro
T Ishizaki et al.
The EMBO journal, 15(8), 1885-1893 (1996-04-15)
The small GTP-binding protein Rho functions as a molecular switch in the formation of focal adhesions and stress fibers, cytokinesis and transcriptional activation. The biochemical mechanism underlying these actions remains unknown. Using a ligand overlay assay, we purified a 160

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service