Skip to Content
Merck
All Photos(8)

Key Documents

HPA031059

Sigma-Aldrich

Anti-GPT antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab1

Synonym(s):

Anti-ALT1, Anti-GPT1, Anti-PSD-95, Anti-PSD95, Anti-SAP-90, Anti-SAP90, Anti-glutamic-pyruvate transaminase (alanine aminotransferase)

Sign Into View Organizational & Contract Pricing
All Photos(8)

About This Item

MDL number:
MFCD03791419
UNSPSC Code:
12352203
Human Protein Atlas Number:
HPA031059
NACRES:
NA.41

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

mouse, human, rat

enhanced validation

independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

immunogen sequence

MASSTGDRSQAVRNGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFT

UniProt accession no.

P24298

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GPT(2875)

General description

The GPT (Glutamate pyruvate transaminase 1) gene is mapped to human chromosome 8q24.3.The gene consists of 11 exons, and encodes a protein of 495 amino acids and is identical to the human GPT-1.

Immunogen

glutamic-pyruvate transaminase (alanine aminotransferase) recombinant protein epitope signature tag (PrEST)

Application

Anti-GPT antibody produced in rabbit has been used in western blotting.

Biochem/physiol Actions

Serum GPT serves as a common biomarker in screening chronic liver injury. GPT levels identify the risk of osteoporosis in non alcoholic fatty liver disease.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST76355

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Long-term intake of a high-protein diet increases liver triacylglycerol deposition pathways and hepatic signs of injury in rats.
Diaz-Rua R
The Journal of Nutritional Biochemistry, 46, 39-48 (2017)
The association of liver fat content and serum alanine aminotransferase with bone mineral density in middle-aged and elderly Chinese men and postmenopausal women.
Xia MF
Journal of Translational Medicine, 14:11, 1-20 (2016)
Higher Ratio of Serum Alpha-Fetoprotein Could Predict Outcomes in Patients with Hepatitis B Virus-Associated Hepatocellular Carcinoma and Normal Alanine Aminotransferase.
Kim YI
PLoS ONE, 11(6), 1-12 (2016)
Rubén Díaz-Rúa et al.
The Journal of nutritional biochemistry, 46, 39-48 (2017-04-30)
Intake of high-protein (HP) diets has increased over the last years, mainly due to their popularity for body weight control. Liver is the main organ handling ingested macronutrients and it is associated with the beginning of different pathologies. We aimed
M M Sohocki et al.
Genomics, 40(2), 247-252 (1997-03-01)
Two frequent protein variants of glutamate pyruvate transminase (GPT) (E.C.2.6.1.2) have been used as genetic markers in humans for more than two decades, although chromosomal mapping of the GPT locus in the 1980s produced conflicting results. To resolve this conflict

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service