Skip to Content
Merck
All Photos(6)

Key Documents

HPA031032

Sigma-Aldrich

Anti-AOC1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-ABP1, Anti-AOC1, Anti-Amiloride binding protein 1 (amine oxidase (copper-containing)), Anti-DAO

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

TKPLHQFFLNTTGFSFQDCHDRCLAFTDVAPRGVASGQRRSWLIIQRYVEGYFLHPTGLELLVDHGSTDAGHWA

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ABP1(26)

Related Categories

General description

AOC1 (amine oxidase, copper containing 1) is mapped to human chromosome 7q36.1. AOC1 codes for a histamine-degrading enzyme diamine oxidase. The encoded protein is highly expressed in mature upper villus cells of the intestinal mucosa.

Immunogen

amiloride binding protein 1 (amine oxidase (copper-containing)) recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-AOC1 antibody produced in rabbit has been used in western blotting.

Biochem/physiol Actions

AOC1 (amine oxidase, copper containing 1) catalyzes the oxidative deamination of primary amines to the corresponding aldehydes. It breaks down polyamines and histamine. Mutation in the gene causes histamine intolerance due to excess of histamine. Decreased expression of AOC1 might be associated with the risk of migraine, especially in women of Caucasian Spanish origin.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST77696

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

A new crystal form of human diamine oxidase.
McGrath AP
Acta Crystallographica Section F, Structural Biology and Crystallization Communications, 66(Pt 2), 137-142 (2010)
Plasma diamine oxidase activity is a useful biomarker for evaluating gastrointestinal tract toxicities during chemotherapy with oral fluorouracil anti-cancer drugs in patients with gastric cancer.
Namikawa T
Oncology, 82(3), 147-152 (2012)
Association of single nucleotide polymorphisms in the diamine oxidase gene with diamine oxidase serum activities.
Maintz L
Allergy, 66(7), 893-902 (2011)
Characterization of recombinant human diamine oxidase (rhDAO) produced in Chinese Hamster Ovary (CHO) cells.
Gludovacz E
Journal of Biotechnology, 227, 120-130 (2016)
Diamine oxidase rs10156191 and rs2052129 variants are associated with the risk for migraine.
Garcia-Martin E
Headache, 55(2), 276-286 (2015)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service