Skip to Content
Merck
All Photos(1)

Documents

HPA038211

Sigma-Aldrich

Anti-SIK1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-SNF1LK, Anti-msk

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

YLLLERLKEYRNAQCARPGPARQPRPRSSDLSGLEVPQEGLSTDPFRPALLCPQPQTLVQSVLQAEMDCELQSSLQWPLFFPVDASCSGVF

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SIK1(150094)

General description

Serine/threonine-protein kinase (SIK1) also called salt-inducible kinase 1 or sucrose nonfermented 1-like kinase is a serine/threonine kinase. SIK has an N-terminal kinase domain, a central ubiquitin-associated (UBA) domain. SIK1 is mapped to human chromosome 21q22.3.

Immunogen

salt-inducible kinase 1

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-SIK1 antibody produced in rabbit has been used in the detection of SIK1 protein in human tumor samples using immunohistochemistry.

Biochem/physiol Actions

Serine/threonine-protein kinase (SIK1) interacts with mothers against decapentaplegic homolog 7 (SMAD7) and regulates transforming growth factor β (TGFβ) signalling. SIK1 is associated with tuning of circadian rhythms. SIK1 modulates intracellular sodium levels by coordinating with Na+,K+-ATPase. Mutations in the SIK1 gene is implicated in epilepsy disorder. A truncated SIK1 protein contributes to developmental epilepsy.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST87281

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

De novo mutations in SIK1 cause a spectrum of developmental epilepsies
Hansen J, et al.
American Journal of Human Genetics, 96(4), 682-690 (2015)
SIK1 is part of a cell sodium-sensing network that regulates active sodium transport through a calcium-dependent process
Sjostrom M, et al.
Proceedings of the National Academy of Sciences of the USA, 104(43), 16922-16927 (2007)
TGFbeta induces SIK to negatively regulate type I receptor kinase signaling
Kowanetz M, et al.
The Journal of Cell Biology, 182(4), 655-662 (2008)
Epilepsy-causing sequence variations in SIK1 disrupt synaptic activity response gene expression and affect neuronal morphology
Proschel C, et al.
European Journal of Human Genetics, 25(2), 216-216 (2017)
The CRTC1-SIK1 pathway regulates entrainment of the circadian clock
Jagannath A, et al.
Cell, 154(5), 1100-1111 (2013)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service